SLITRK1 antibody (N-Term)

Catalog No. ABIN635858

Product Details anti-SLITRK1 Antibody

Target: SLITRK1 (SLIT and NTRK-Like Family, Member 1 (SLITRK1))

Binding Specificity: N-Term

Reactivity: Rat, Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLITRK1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLITRK1 antibody was raised against the N terminal of SLITRK1

Purification: Affinity purified

Immunogen: SLITRK1 antibody was raised using the N terminal of SLITRK1 corresponding to a region with amino acids CDLLSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLITRK1 Blocking Peptide, catalog no. 33R-1668, is also available for use as a blocking control in assays to test for specificity of this SLITRK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLITRK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLITRK1

Target: SLITRK1 (SLIT and NTRK-Like Family, Member 1 (SLITRK1))

Alternative Name: SLITRK1 (SLITRK1 Products)

Synonyms: DKFZp459G0529 antibody, LRRC12 antibody, TTM antibody, 3200001I04Rik antibody, SLIT and NTRK like family member 1 antibody, SLIT and NTRK-like family, member 1 antibody, SLITRK1 antibody, slitrk1 antibody, Slitrk1 antibody

Background: Members of the SLITRK family, such as SLITRK1, are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins. Most SLITRKs, but not SLITRK1, also have C-terminal regions that share homology with neurotrophin receptors. SLITRKs are expressed predominantly in neural tissues and have neurite-modulating activity.

Molecular Weight: 78 kDa (MW of target protein)