Neuropilin 1 antibody (N-Term)
-
- Target See all Neuropilin 1 (NRP1) Antibodies
- Neuropilin 1 (NRP1)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Neuropilin 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Neuropilin antibody was raised against the N terminal of NETO2
- Purification
- Affinity purified
- Immunogen
- Neuropilin antibody was raised using the N terminal of NETO2 corresponding to a region with amino acids GIKHIPATQCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEAAPRQRIE
- Top Product
- Discover our top product NRP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Neuropilin Blocking Peptide, catalog no. 33R-3329, is also available for use as a blocking control in assays to test for specificity of this Neuropilin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NETO2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Neuropilin 1 (NRP1)
- Alternative Name
- Neuropilin (NRP1 Products)
- Synonyms
- NRP1 antibody, cd304 antibody, neuropilin antibody, np-1 antibody, npn-1 antibody, nrp antibody, nrp-1 antibody, vegf165r antibody, BDCA4 antibody, CD304 antibody, NP1 antibody, NRP antibody, VEGF165R antibody, C530029I03 antibody, NP-1 antibody, NPN-1 antibody, Npn1 antibody, Nrp antibody, neuropilin 1 antibody, neuropilin 1 L homeolog antibody, NRP1 antibody, nrp1 antibody, Nrp1 antibody, nrp1.L antibody
- Background
- NETO2 is a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis.
- Molecular Weight
- 57 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size, Signaling Events mediated by VEGFR1 and VEGFR2, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling, VEGFR1 Specific Signals
-