Growth Hormone Receptor antibody (N-Term)

Catalog No. ABIN635863

Product Details anti-Growth Hormone Receptor Antibody

Target: Growth Hormone Receptor (GHR)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Growth Hormone Receptor antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GHR antibody was raised against the N terminal of GHR

Purification: Affinity purified

Immunogen: GHR antibody was raised using the N terminal of GHR corresponding to a region with amino acids LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GHR Blocking Peptide, catalog no. 33R-5341, is also available for use as a blocking control in assays to test for specificity of this GHR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GHR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Growth Hormone Receptor

Target: Growth Hormone Receptor (GHR)

Alternative Name: GHR (GHR Products)

Synonyms: GHBP antibody, AA986417 antibody, GHR/BP antibody, GHR antibody, ghr antibody, ghr.a antibody, zgc:162141 antibody, growth hormone receptor antibody, growth hormone receptor L homeolog antibody, growth hormone receptor a antibody, GHR antibody, Ghr antibody, ghr.L antibody, ghr antibody, ghra antibody

Background: GHR is a protein that is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. A common alternate allele of this gene, called GHRd3, lacks exon three and has been well-characterized. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature.

Molecular Weight: 70 kDa (MW of target protein)

Pathways: NF-kappaB Signaling, JAK-STAT Signaling, Response to Growth Hormone Stimulus