FZD6 antibody

Catalog No. ABIN635881

Product Details anti-FZD6 Antibody

Target: FZD6 (Frizzled Family Receptor 6 (FZD6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FZD6 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: FZD6 antibody was raised using a synthetic peptide corresponding to a region with amino acids HKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FZD6 Blocking Peptide, catalog no. 33R-3764, is also available for use as a blocking control in assays to test for specificity of this FZD6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FZD6

Target: FZD6 (Frizzled Family Receptor 6 (FZD6))

Alternative Name: FZD6 (FZD6 Products)

Synonyms: zgc:65879 antibody, zgc:77440 antibody, fz6 antibody, frz6 antibody, Xfrz6 antibody, frizzled6 antibody, frizzled-6 antibody, FZ-6 antibody, FZ6 antibody, HFZ6 antibody, NDNC10 antibody, Frizzled-6 antibody, Fz6 antibody, frizzled class receptor 6 antibody, frizzled class receptor 6 S homeolog antibody, fzd6 antibody, fzd6.S antibody, FZD6 antibody, Fzd6 antibody

Background: This gene represents a member of the 'frizzled' gene family, which encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins.

Molecular Weight: 79 kDa (MW of target protein)

Pathways: WNT Signaling, Tube Formation