FZD6 antibody
-
- Target See all FZD6 Antibodies
- FZD6 (Frizzled Family Receptor 6 (FZD6))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FZD6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- FZD6 antibody was raised using a synthetic peptide corresponding to a region with amino acids HKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTE
- Top Product
- Discover our top product FZD6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FZD6 Blocking Peptide, catalog no. 33R-3764, is also available for use as a blocking control in assays to test for specificity of this FZD6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FZD6 (Frizzled Family Receptor 6 (FZD6))
- Alternative Name
- FZD6 (FZD6 Products)
- Synonyms
- zgc:65879 antibody, zgc:77440 antibody, fz6 antibody, frz6 antibody, Xfrz6 antibody, frizzled6 antibody, frizzled-6 antibody, FZ-6 antibody, FZ6 antibody, HFZ6 antibody, NDNC10 antibody, Frizzled-6 antibody, Fz6 antibody, frizzled class receptor 6 antibody, frizzled class receptor 6 S homeolog antibody, fzd6 antibody, fzd6.S antibody, FZD6 antibody, Fzd6 antibody
- Background
- This gene represents a member of the 'frizzled' gene family, which encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins.
- Molecular Weight
- 79 kDa (MW of target protein)
- Pathways
- WNT Signaling, Tube Formation
-