EMID1 antibody (C-Term)

Catalog No. ABIN635896

Product Details anti-EMID1 Antibody

Target: EMID1 (EMI Domain Containing 1 (EMID1))

Binding Specificity: C-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EMID1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EMID1 antibody was raised against the C terminal of EMID1

Purification: Affinity purified

Immunogen: EMID1 antibody was raised using the C terminal of EMID1 corresponding to a region with amino acids TMIGLYEPELGSGAGPAGTGTPSLLRGKRGGHATNYRIVAPRSRDERG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EMID1 Blocking Peptide, catalog no. 33R-9201, is also available for use as a blocking control in assays to test for specificity of this EMID1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EMID1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EMID1

Target: EMID1 (EMI Domain Containing 1 (EMID1))

Alternative Name: EMID1 (EMID1 Products)

Synonyms: EMI5 antibody, EMU1 antibody, AW122071 antibody, CO-5 antibody, Emu1 antibody, RGD1565846 antibody, EMI domain containing 1 antibody, EMID1 antibody, Emid1 antibody

Background: EMID1 contains 1 collagen-like domain and 1 EMI domain. The exact function of EMID1 remains unknown.

Molecular Weight: 45 kDa (MW of target protein)