GPR27 antibody (Middle Region)
-
- Target See all GPR27 Antibodies
- GPR27 (G Protein-Coupled Receptor 27 (GPR27))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GPR27 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GPR27 antibody was raised against the middle region of GPR27
- Purification
- Affinity purified
- Immunogen
- GPR27 antibody was raised using the middle region of GPR27 corresponding to a region with amino acids LVCAAWALALAAAFPPVLDGGGDDEDAPCALEQRPDGAPGALGFLLLLAV
- Top Product
- Discover our top product GPR27 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GPR27 Blocking Peptide, catalog no. 33R-5502, is also available for use as a blocking control in assays to test for specificity of this GPR27 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR27 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPR27 (G Protein-Coupled Receptor 27 (GPR27))
- Alternative Name
- GPR27 (GPR27 Products)
- Synonyms
- SREB1 antibody, Sreb1 antibody, G protein-coupled receptor 27 antibody, gpr27 antibody, GPR27 antibody, Gpr27 antibody
- Background
- GPR27 belongs to the G-protein coupled receptor 1 family. GPR27 is an orphan receptor. It is a possible candidate for amine-like G-protein coupled receptor.
- Molecular Weight
- 40 kDa (MW of target protein)
-