RNF43 antibody (Middle Region)

Catalog No. ABIN635909

Product Details anti-RNF43 Antibody

Target: RNF43 (Ring Finger Protein 43 (RNF43))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF43 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RNF43 antibody was raised against the middle region of RNF43

Purification: Affinity purified

Immunogen: RNF43 antibody was raised using the middle region of RNF43 corresponding to a region with amino acids DFDPLVYCSPKGDPQRVDMQPSVTSRPRSLDSVVPTGETQVSSHVHYHRH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF43 Blocking Peptide, catalog no. 33R-1926, is also available for use as a blocking control in assays to test for specificity of this RNF43 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF43 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF43

Target: RNF43 (Ring Finger Protein 43 (RNF43))

Alternative Name: RNF43 (RNF43 Products)

Synonyms: RNF124 antibody, URCC antibody, 4732452J19Rik antibody, RGD1305204 antibody, ring finger protein 43 antibody, RNF43 antibody, Rnf43 antibody

Background: RNF43 is a HAP95 (AKAP8L) binding ubiquitin ligase that promotes cell growth and is upregulated in colon cancer.

Molecular Weight: 86 kDa (MW of target protein)

Pathways: WNT Signaling