ACP2 antibody (Middle Region)
-
- Target See all ACP2 Antibodies
- ACP2 (Acid Phosphatase 2, Lysosomal (ACP2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ACP2 antibody was raised against the middle region of ACP2
- Purification
- Affinity purified
- Immunogen
- ACP2 antibody was raised using the middle region of ACP2 corresponding to a region with amino acids VPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANET
- Top Product
- Discover our top product ACP2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACP2 Blocking Peptide, catalog no. 33R-9731, is also available for use as a blocking control in assays to test for specificity of this ACP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACP2 (Acid Phosphatase 2, Lysosomal (ACP2))
- Alternative Name
- ACP2 (ACP2 Products)
- Synonyms
- ACP2 antibody, Acp-2 antibody, LAP antibody, acid phosphatase 2, lysosomal antibody, acid phosphatase 2, lysosomal S homeolog antibody, ACP2 antibody, acp2 antibody, Acp2 antibody, acp2.S antibody
- Background
- ACP2 is the beta subunit of lysosomal acid phosphatase (LAP). LAP is chemically and genetically distinct from red cell acid phosphatase. The protein belongs to a family of distinct isoenzymes which hydrolyze orthophosphoric monoesters to alcohol and phosphate. Mutations in this gene or in the related alpha subunit gene cause acid phosphatase deficiency.
- Molecular Weight
- 45 kDa (MW of target protein)
-