ABCB9 antibody

Catalog No. ABIN635922

Product Details anti-ABCB9 Antibody

Target: ABCB9 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 9 (ABCB9))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCB9 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ABCB9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABCB9 Blocking Peptide, catalog no. 33R-8059, is also available for use as a blocking control in assays to test for specificity of this ABCB9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCB9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABCB9

Target: ABCB9 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 9 (ABCB9))

Alternative Name: ABCB9 (ABCB9 Products)

Synonyms: ABCB9 antibody, si:dkey-21k4.3 antibody, EST122234 antibody, TAPL antibody, mKIAA1520 antibody, Tapl antibody, ATP binding cassette subfamily B member 9 antibody, ATP-binding cassette, sub-family B (MDR/TAP), member 9 antibody, ABCB9 antibody, abcb9 antibody, Abcb9 antibody

Background: ABCB9, a membrane-associated protein, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABCB9 is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. The function of this half-transporter has not yet been determined, however, this protein may play a role in lysosomes.

Molecular Weight: 80 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process