SLC22A12 antibody
-
- Target See all SLC22A12 Antibodies
- SLC22A12 (Solute Carrier Family 22 (Organic Anion/urate Transporter), Member 12 (SLC22A12))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC22A12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC22 A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMLENFSAAVPSHRCWAPLLDNSTAQASILGSLSPEALLAISIPPGPNQR
- Top Product
- Discover our top product SLC22A12 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC22A12 Blocking Peptide, catalog no. 33R-8641, is also available for use as a blocking control in assays to test for specificity of this SLC22A12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC22A12 (Solute Carrier Family 22 (Organic Anion/urate Transporter), Member 12 (SLC22A12))
- Alternative Name
- SLC22A12 (SLC22A12 Products)
- Synonyms
- AI987855 antibody, OAT4L antibody, Rst antibody, Slc22al2 antibody, URAT1 antibody, RST antibody, solute carrier family 22 (organic anion/cation transporter), member 12 antibody, solute carrier family 22 member 12 antibody, Slc22a12 antibody, SLC22A12 antibody
- Background
- SLC22A12 is required for efficient urate re-absorption in the kidney. SLC22A12 regulates blood urate levels. SLC22A12 mediates saturable urate uptake by facilitating the exchange of urate against organic anions.
- Molecular Weight
- 59 kDa (MW of target protein)
-