SLC5A8 antibody
-
- Target See all SLC5A8 Antibodies
- SLC5A8 (Solute Carrier Family 5 (Iodide Transporter), Member 8 (SLC5A8))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC5A8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC5 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids GILVPFANSIGALVGLMAGFAISLWVGIGAQIYPPLPERTLPLHLDIQGC
- Top Product
- Discover our top product SLC5A8 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC5A8 Blocking Peptide, catalog no. 33R-3337, is also available for use as a blocking control in assays to test for specificity of this SLC5A8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC5A8 (Solute Carrier Family 5 (Iodide Transporter), Member 8 (SLC5A8))
- Alternative Name
- SLC5A8 (SLC5A8 Products)
- Synonyms
- Ait antibody, SMCT antibody, SMCT1 antibody, AIT antibody, RGD1564146 antibody, solute carrier family 5 (iodide transporter), member 8 antibody, solute carrier family 5 member 8 antibody, Slc5a8 antibody, SLC5A8 antibody
- Background
- SLC5A8 has been shown to transport iodide by a passive mechanism and monocarboxylates and short-chain fatty acids by a sodium-coupled mechanism.
- Molecular Weight
- 66 kDa (MW of target protein)
-