DNAJB9 antibody
-
- Target See all DNAJB9 Antibodies
- DNAJB9 (Microvascular Endothelial Differentiation Gene 1 Protein (DNAJB9))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DNAJB9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DNAJB9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLA
- Top Product
- Discover our top product DNAJB9 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DNAJB9 Blocking Peptide, catalog no. 33R-5786, is also available for use as a blocking control in assays to test for specificity of this DNAJB9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJB9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DNAJB9 (Microvascular Endothelial Differentiation Gene 1 Protein (DNAJB9))
- Alternative Name
- DNAJB9 (DNAJB9 Products)
- Synonyms
- ERdj4 antibody, MDG-1 antibody, MDG1 antibody, MST049 antibody, MSTP049 antibody, AA408011 antibody, AA673251 antibody, AA673481 antibody, AW556981 antibody, Mdg1 antibody, mDj7 antibody, DnaJ heat shock protein family (Hsp40) member B9 antibody, DNAJB9 antibody, Dnajb9 antibody
- Background
- DNAJB9 acts as a co-chaperone with an Hsp70 protein.
- Molecular Weight
- 25 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-