TMX2 antibody (Middle Region)

Catalog No. ABIN635980

Product Details anti-TMX2 Antibody

Target: TMX2 (Thioredoxin-Related Transmembrane Protein 2 (TMX2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMX2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TXNDC14 antibody was raised against the middle region of TXNDC14

Purification: Affinity purified

Immunogen: TXNDC14 antibody was raised using the middle region of TXNDC14 corresponding to a region with amino acids IRMGLLYITLCIVFLMTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TXNDC14 Blocking Peptide, catalog no. 33R-4138, is also available for use as a blocking control in assays to test for specificity of this TXNDC14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMX2

Target: TMX2 (Thioredoxin-Related Transmembrane Protein 2 (TMX2))

Alternative Name: TXNDC14 (TMX2 Products)

Synonyms: PDIA12 antibody, PIG26 antibody, TXNDC14 antibody, 2310042M24Rik antibody, AA589631 antibody, Txndc14 antibody, tmx2 antibody, txndc14 antibody, wu:fb73h06 antibody, zgc:86830 antibody, pig26 antibody, cgi-31 antibody, MGC79568 antibody, DKFZp469G2332 antibody, im:7138651 antibody, zgc:172264 antibody, thioredoxin related transmembrane protein 2 antibody, thioredoxin-related transmembrane protein 2 antibody, thioredoxin-related transmembrane protein 2b antibody, thioredoxin domain containing 14 antibody, thioredoxin related transmembrane protein 2 S homeolog antibody, thioredoxin-related transmembrane protein 2a antibody, TMX2 antibody, Tmx2 antibody, tmx2b antibody, tmx2 antibody, CpipJ_CPIJ000873 antibody, tmx2.S antibody, tmx2a antibody

Background: The function of TXNDC14 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 34 kDa (MW of target protein)