PGAP3 antibody (N-Term)
-
- Target See all PGAP3 Antibodies
- PGAP3 (Post-GPI Attachment To Proteins 3 (PGAP3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PGAP3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PERLD1 antibody was raised against the N terminal of PERLD1
- Purification
- Affinity purified
- Immunogen
- PERLD1 antibody was raised using the N terminal of PERLD1 corresponding to a region with amino acids ECMWVTVGLYLQEGHKVPQFHGKWPFSRFLFFQEPASAVASFLNGLASLV
- Top Product
- Discover our top product PGAP3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PERLD1 Blocking Peptide, catalog no. 33R-2299, is also available for use as a blocking control in assays to test for specificity of this PERLD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PERLD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PGAP3 (Post-GPI Attachment To Proteins 3 (PGAP3))
- Alternative Name
- PERLD1 (PGAP3 Products)
- Synonyms
- GB10206 antibody, AGLA546 antibody, CAB2 antibody, PER1 antibody, PERLD1 antibody, PP1498 antibody, D430035D22Rik antibody, Perld1 antibody, perld1 antibody, pgap3 antibody, post-GPI attachment to proteins factor 3 antibody, post-GPI attachment to proteins 3 antibody, post-GPI attachment to proteins 3 L homeolog antibody, LOC412085 antibody, PGAP3 antibody, Pgap3 antibody, pgap3.L antibody, pgap3 antibody
- Background
- PERLD1 is involved in the lipid remodeling steps of GPI-anchor maturation. Lipid remodeling steps consist in the generation of 2 saturated fatty chains at the sn-2 position of GPI-anchors proteins. It is required for phospholipase A2 activity that removes an acyl-chain at the sn-2 position of GPI-anchors during the remodeling of GPI.
- Molecular Weight
- 36 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-