Aquaporin 10 antibody (Middle Region)
-
- Target See all Aquaporin 10 (AQP10) Antibodies
- Aquaporin 10 (AQP10)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Aquaporin 10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Aquaporin 10 antibody was raised against the middle region of AQP10
- Purification
- Affinity purified
- Immunogen
- Aquaporin 10 antibody was raised using the middle region of AQP10 corresponding to a region with amino acids VGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECK
- Top Product
- Discover our top product AQP10 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Aquaporin 10 Blocking Peptide, catalog no. 33R-9547, is also available for use as a blocking control in assays to test for specificity of this Aquaporin 10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AQP10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Aquaporin 10 (AQP10)
- Alternative Name
- Aquaporin 10 (AQP10 Products)
- Synonyms
- aqp10 antibody, zgc:92167 antibody, AQP10 antibody, AQPA_HUMAN antibody, aquaporin 10a antibody, aquaporin 10 antibody, similar to aquaporin 10 antibody, aqp10a antibody, AQP10 antibody, LOC686596 antibody
- Background
- AQP10 is a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. AQP10 was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea.
- Molecular Weight
- 32 kDa (MW of target protein)
-