RDH10 antibody
-
- Target See all RDH10 Antibodies
- RDH10 (Retinol Dehydrogenase 10 (All-Trans) (RDH10))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RDH10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RDH10 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG
- Top Product
- Discover our top product RDH10 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RDH10 Blocking Peptide, catalog no. 33R-7732, is also available for use as a blocking control in assays to test for specificity of this RDH10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDH10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RDH10 (Retinol Dehydrogenase 10 (All-Trans) (RDH10))
- Alternative Name
- RDH10 (RDH10 Products)
- Synonyms
- cb804 antibody, rdh10 antibody, SDR16C4 antibody, 3110069K09Rik antibody, 4921506A21Rik antibody, AI875664 antibody, AW549993 antibody, D1Ertd762e antibody, m366Asp antibody, retinol dehydrogenase 10b antibody, retinol dehydrogenase 10 antibody, retinol dehydrogenase 10 (all-trans) antibody, rdh10b antibody, MCYG_00691 antibody, RDH10 antibody, Rdh10 antibody
- Background
- RDH10 is a retinol dehydrogenase with a clear preference for NADP. RDH10 converts all-trans-retinol to all-trans-retinal. RDH10 has no detectable activity towards 11-cis-retinol, 9-cis-retinol and 13-cis-retinol.RDH10 generates all-trans retinal from all-trans retinol and may plan an important role in the photic visual cycle.
- Molecular Weight
- 38 kDa (MW of target protein)
-