APOB antibody (Middle Region)
-
- Target See all APOB Antibodies
- APOB (Apolipoprotein B (APOB))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This APOB antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ApoB antibody was raised against the middle region of APOB
- Purification
- Affinity purified
- Immunogen
- ApoB antibody was raised using the middle region of APOB corresponding to a region with amino acids SPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV
- Top Product
- Discover our top product APOB Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ApoB Blocking Peptide, catalog no. 33R-8668, is also available for use as a blocking control in assays to test for specificity of this ApoB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APOB (Apolipoprotein B (APOB))
- Alternative Name
- ApoB (APOB Products)
- Synonyms
- FLDB antibody, LDLCQ4 antibody, Ac1-060 antibody, Apo B-100 antibody, ApoB-100 antibody, ApoB-48 antibody, AI315052 antibody, apob-100 antibody, apob-48 antibody, APOB-100 antibody, ApoB(100) antibody, APOB antibody, apolipoprotein B antibody, APOB antibody, Apob antibody
- Background
- This gene product is the main apolipoprotein of chylomicrons and low density lipoproteins. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver.
- Molecular Weight
- 241 kDa (MW of target protein)
- Pathways
- Lipid Metabolism
-