CYP4B1 antibody (N-Term)
-
- Target See all CYP4B1 Antibodies
- CYP4B1 (Cytochrome P450, Family 4, Subfamily B, Polypeptide 1 (CYP4B1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP4B1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CYP4 B1 antibody was raised against the N terminal of CYP4 1
- Purification
- Affinity purified
- Immunogen
- CYP4 B1 antibody was raised using the N terminal of CYP4 1 corresponding to a region with amino acids SWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQW
- Top Product
- Discover our top product CYP4B1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CYP4B1 Blocking Peptide, catalog no. 33R-8937, is also available for use as a blocking control in assays to test for specificity of this CYP4B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP4B1 (Cytochrome P450, Family 4, Subfamily B, Polypeptide 1 (CYP4B1))
- Alternative Name
- CYP4B1 (CYP4B1 Products)
- Synonyms
- CYPIVB1 antibody, P-450HP antibody, cytochrome P450, family 4, subfamily B, polypeptide 1 antibody, CYP4B1-like isozyme short form antibody, cytochrome P450, family 4, subfamily B, polypeptide 1 L homeolog antibody, cytochrome P450 family 4 subfamily B member 1 antibody, cytochrome P450, family 4, subfamily b, polypeptide 1 antibody, cytochrome P450 family 4 subfamily B member 1 L homeolog antibody, CYP4B1 antibody, cyp4b1.L antibody, cyp4b1 antibody, Cyp4b1 antibody, cyp4b1.2.L antibody
- Background
- CYP4B1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. In rodents, the homologous protein has been shown to metabolize certain carcinogens, however, the specific function of the human protein has not been determined.
- Molecular Weight
- 59 kDa (MW of target protein)
-