Collagen, Type XXVI, alpha 1 (COL26A1) (C-Term) antibody
-
- Target See all Collagen, Type XXVI, alpha 1 (COL26A1) Antibodies
- Collagen, Type XXVI, alpha 1 (COL26A1)
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EMID2 antibody was raised against the C terminal of EMID2
- Purification
- Affinity purified
- Immunogen
- EMID2 antibody was raised using the C terminal of EMID2 corresponding to a region with amino acids GVQQLREALKILAERVLILEHMIGIHDPLASPEGGSGQDAALRANLKMKR
- Top Product
- Discover our top product COL26A1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EMID2 Blocking Peptide, catalog no. 33R-3653, is also available for use as a blocking control in assays to test for specificity of this EMID2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EMID2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Collagen, Type XXVI, alpha 1 (COL26A1)
- Alternative Name
- EMID2 (COL26A1 Products)
- Synonyms
- EMID2 antibody, EMI6 antibody, EMU2 antibody, Emu2 antibody, SH2B antibody, 9430032K24Rik antibody, BC002218 antibody, Col26a antibody, Emid2 antibody, collagen type XXVI alpha 1 chain antibody, collagen, type XXVI, alpha 1 antibody, COL26A1 antibody, Col26a1 antibody
- Background
- EMID2 contains 1 EMI domain and 2 collagen-like domains. The exact function of ZCCHC3 remains unknown.
- Molecular Weight
- 45 kDa (MW of target protein)
-