TSPAN33 antibody (Middle Region)
-
- Target See all TSPAN33 Antibodies
- TSPAN33 (Tetraspanin 33 (TSPAN33))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TSPAN33 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Tetraspanin 33 antibody was raised against the middle region of TSPAN33
- Purification
- Affinity purified
- Immunogen
- Tetraspanin 33 antibody was raised using the middle region of TSPAN33 corresponding to a region with amino acids LQLAAGILGFVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSC
- Top Product
- Discover our top product TSPAN33 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Tetraspanin 33 Blocking Peptide, catalog no. 33R-5321, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 33 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN33 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TSPAN33 (Tetraspanin 33 (TSPAN33))
- Alternative Name
- Tetraspanin 33 (TSPAN33 Products)
- Synonyms
- zgc:92266 antibody, PEN antibody, 1300010A20Rik antibody, AI035228 antibody, Pen antibody, RGD1560915 antibody, tetraspanin 33 antibody, tetraspanin 33a antibody, tetraspanin 33 L homeolog antibody, TSPAN33 antibody, tspan33a antibody, tspan33.L antibody, Tspan33 antibody
- Background
- TSPAN33 plays an important role in normal erythropoiesis. It has a role in the differentiation of erythroid progenitors.
- Molecular Weight
- 31 kDa (MW of target protein)
-