TSPAN33 antibody (Middle Region)

Catalog No. ABIN636117

Product Details anti-TSPAN33 Antibody

Target: TSPAN33 (Tetraspanin 33 (TSPAN33))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TSPAN33 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Tetraspanin 33 antibody was raised against the middle region of TSPAN33

Purification: Affinity purified

Immunogen: Tetraspanin 33 antibody was raised using the middle region of TSPAN33 corresponding to a region with amino acids LQLAAGILGFVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tetraspanin 33 Blocking Peptide, catalog no. 33R-5321, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 33 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TSPAN33

Target: TSPAN33 (Tetraspanin 33 (TSPAN33))

Alternative Name: Tetraspanin 33 (TSPAN33 Products)

Synonyms: zgc:92266 antibody, PEN antibody, 1300010A20Rik antibody, AI035228 antibody, Pen antibody, RGD1560915 antibody, tetraspanin 33 antibody, tetraspanin 33a antibody, tetraspanin 33 L homeolog antibody, TSPAN33 antibody, tspan33a antibody, tspan33.L antibody, Tspan33 antibody

Background: TSPAN33 plays an important role in normal erythropoiesis. It has a role in the differentiation of erythroid progenitors.

Molecular Weight: 31 kDa (MW of target protein)