BCAP29 antibody (Middle Region)

Catalog No. ABIN636123

Product Details anti-BCAP29 Antibody

Target: BCAP29 (B-Cell Receptor-Associated Protein 29 (BCAP29))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BCAP29 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BCAP29 antibody was raised against the middle region of BCAP29

Purification: Affinity purified

Immunogen: BCAP29 antibody was raised using the middle region of BCAP29 corresponding to a region with amino acids GVMEPQQRNADSHQKLEEAKNRFFPRASSSRSMALQIPIKLILDFLASRT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BCAP29 Blocking Peptide, catalog no. 33R-3644, is also available for use as a blocking control in assays to test for specificity of this BCAP29 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCAP29 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BCAP29

Target: BCAP29 (B-Cell Receptor-Associated Protein 29 (BCAP29))

Alternative Name: BCAP29 (BCAP29 Products)

Synonyms: AW208404 antibody, Bap29 antibody, BAP29 antibody, B-cell receptor associated protein 29 antibody, B cell receptor associated protein 29 antibody, B-cell receptor-associated protein 29 antibody, BCAP29 antibody, Bcap29 antibody

Background: BCAP29 may play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. BCAP29 may be involved in CASP8-mediated apoptosis.

Molecular Weight: 39 kDa (MW of target protein)