BCAP29 antibody (Middle Region)
-
- Target See all BCAP29 Antibodies
- BCAP29 (B-Cell Receptor-Associated Protein 29 (BCAP29))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BCAP29 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- BCAP29 antibody was raised against the middle region of BCAP29
- Purification
- Affinity purified
- Immunogen
- BCAP29 antibody was raised using the middle region of BCAP29 corresponding to a region with amino acids GVMEPQQRNADSHQKLEEAKNRFFPRASSSRSMALQIPIKLILDFLASRT
- Top Product
- Discover our top product BCAP29 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BCAP29 Blocking Peptide, catalog no. 33R-3644, is also available for use as a blocking control in assays to test for specificity of this BCAP29 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCAP29 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BCAP29 (B-Cell Receptor-Associated Protein 29 (BCAP29))
- Alternative Name
- BCAP29 (BCAP29 Products)
- Synonyms
- AW208404 antibody, Bap29 antibody, BAP29 antibody, B-cell receptor associated protein 29 antibody, B cell receptor associated protein 29 antibody, B-cell receptor-associated protein 29 antibody, BCAP29 antibody, Bcap29 antibody
- Background
- BCAP29 may play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. BCAP29 may be involved in CASP8-mediated apoptosis.
- Molecular Weight
- 39 kDa (MW of target protein)
-