HSP70 1A/ 1B antibody

Catalog No. ABIN6654061

Product Details

Target: HSP70 1A/ 1B

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Protein G affinity

Immunogen: Amino acids KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR were used as the immunogen for the HSP70 antibody. This sequence is common to HSPA1A and HSPA1B.

Clone: 3H5

Isotype: IgG1

Application Details

Application Notes: Optimal dilution of the HSP70 antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,Immunohistochemistry (FFPE): 1-2 μg/mL,Flow Cytometry: 1-3 μg/10^6 cells

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the HSP70 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details

Target: HSP70 1A/ 1B

Alternative Name: HSP70 / HSPA1A / HSPA1B

Background: HSPA1 (Heat Shock 70 kDa Protein 1A) also known as HSP70-1, HSPA1A, HSP70-1A, HSP72 or HSP70I, is a protein that in humans is encoded by the HSPA1A gene. This intronless gene encodes a 70 kDa heat shock protein which is a member of the heat shock protein 70 family. The HSPA1A gene encodes a predicted 641-amino acid protein. The HSPA1 gene is mapped on 6p21.33. Shimizu et al. (1999) found that peripheral blood mononuclear cells of 18 major depression patients expressed a short HSPA1A transcript that utilized exon 1 rather than exon 2, which is found in the more common HSPA1A transcript. No protein was associated with expression of this short HSPA1A mRNA, possibly due to lack of a TATA box or loss of internal ribosome binding sites. Treatment with BGP-15, a pharmacologic inducer of Hsp72 that can protect against obesity-induced insulin resistance, improved muscular architecture, strength, and contractile function in severely affected diaphragm muscles in mdx dystrophic mice.

UniProt: P0DMV8