Aquaporin 5 antibody
-
- Target See all Aquaporin 5 (AQP5) Antibodies
- Aquaporin 5 (AQP5)
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Aquaporin 5 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Aquaporin 5 detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- NSLSLSERVA IIKGTYEPDE DWEEQREERK KTMELTTR
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
- Rabbit IgG polyclonal antibody for Aquaporin 5 detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence of human Aquaporin 5 (NSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR).
- Isotype
- IgG
- Top Product
- Discover our top product AQP5 Primary Antibody
-
-
- Application Notes
-
Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL
- Comment
-
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- Aquaporin 5 (AQP5)
- Alternative Name
- AQP5 (AQP5 Products)
- Synonyms
- AQP-5 antibody, AQP5 antibody, LOC100231329 antibody, aquaporin 5 antibody, aquaporin-5 antibody, AQP5 antibody, Aqp5 antibody, LOC711804 antibody, LOC100231329 antibody
- Background
-
Synonyms: Aquaporin-5, AQP-5, AQP5
Background: Aquaporin 5, also known as AQP5, is a water channel protein. The aquaporins (AQPs) are a family of more than 10 homologous water transporting proteins expressed in many mammalian epithelia and endothelia. At least five AQPs are expressed in the eye: AQP0 (MIP) in lens fiber, AQP1 in cornea endothelium, ciliary and lens epithelia and trabecular meshwork, AQP3 in conjunctiva, AQP4 in ciliary epithelium and retinal Müller cells, and AQP5 in corneal and lacrimal gland epithelia. Among the seven human aquaporins cloned to date (AQPs 0-6), genes encoding the four most closely related aquaporins (AQP0, AQP2, AQP5, and AQP6) have been mapped to chromosome band 12q13, suggesting an aquaporin family gene cluster at this locus. Aquaporin 5 plays a role in the generation of saliva, tears and pulmonary secretions.
- Gene ID
- 362
- UniProt
- P55064
-