FZD10 antibody
-
- Target See all FZD10 Antibodies
- FZD10 (Frizzled Family Receptor 10 (FZD10))
-
Reactivity
- Human, Pig
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FZD10 antibody is un-conjugated
-
Application
- Immunofluorescence (IF)
- Specificity
- Human FZD10 / Frizzled 10
- Purification
- Immunoaffinity purified
- Immunogen
-
The immunogen for anti-FZD10 antibody: synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH. Percent identity by BLAST analysis: Pig, Human (100%), Dog, Horse, Mouse, Bovine (92%).
Type of Immunogen: Synthetic peptide - Top Product
- Discover our top product FZD10 Primary Antibody
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
-
Target Species of Antibody: Human
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Distilled water
- Concentration
- Lot specific
- Buffer
- Lyophilized from PBS, 2 % sucrose.
- Handling Advice
- Avoid freeze-thaw cycles.
- Storage
- 4 °C,-20 °C
- Storage Comment
- Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.
-
- Target
- FZD10 (Frizzled Family Receptor 10 (FZD10))
- Alternative Name
- FZD10 / Frizzled 10 (FZD10 Products)
- Synonyms
- CD350 antibody, FZ-10 antibody, Fz10 antibody, FzE7 antibody, hFz10 antibody, cFz-10 antibody, Fz-10 antibody, Xfr9 antibody, Xfz10 antibody, frizzled-10 antibody, frizzled10 antibody, fz10 antibody, fze7 antibody, hfz10 antibody, fk48e04 antibody, fz4 antibody, fzb antibody, wu:fk48e04 antibody, zg04 antibody, Xfz10A antibody, fzd10a antibody, Xfz10B antibody, Xfz9 antibody, fzd10b antibody, fzd9 antibody, frizzled class receptor 10 antibody, frizzled class receptor 10 L homeolog antibody, frizzled class receptor 10 S homeolog antibody, FZD10 antibody, fzd10 antibody, Fzd10 antibody, fzd10.L antibody, fzd10.S antibody
- Background
-
Name/Gene ID: FZD10
Subfamily: Frizzled
Family: GPCR
Synonyms: FZD10, CD350 antigen, CD350, FZ-10, Frizzled homolog 10, HFz10, Frizzled 10, Frizzled family receptor 10, Frizzled-10, FzE7, Fz10 - Gene ID
- 11211
- Pathways
- WNT Signaling
-