ZNF566 antibody (Internal Region)
-
- Target See all ZNF566 Antibodies
- ZNF566 (Zinc Finger Protein 566 (ZNF566))
-
Binding Specificity
- Internal Region
-
Reactivity
- Human, Horse, Rat, Guinea Pig, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZNF566 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Rat Zpf566
- Purification
- Immunoaffinity purified
- Immunogen
-
The immunogen for anti-Zfp566 antibody: synthetic peptide directed towards the following sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI. Percent identity by BLAST analysis: Rat, Horse, Human, Mouse (100%), Dog, Pig, Bovine, Rabbit, Zebrafish (93%), Guinea pig (86%).
Type of Immunogen: Synthetic peptide - Top Product
- Discover our top product ZNF566 Primary Antibody
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
-
Target Species of Antibody: Rat
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Distilled water
- Concentration
- Lot specific
- Buffer
- Lyophilized from PBS, 2 % sucrose.
- Handling Advice
- Avoid freeze-thaw cycles.
- Storage
- 4 °C,-20 °C
- Storage Comment
- Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.
-
- Target
- ZNF566 (Zinc Finger Protein 566 (ZNF566))
- Alternative Name
- Zfp566 (ZNF566 Products)
- Synonyms
- ZNF420 antibody, RGD1563239 antibody, zinc finger protein 566 antibody, ZNF566 antibody, Zfp566 antibody
- Background
-
Name/Gene ID: Zfp566
Synonyms: Zfp566 - Gene ID
- 502316
-