MAP3K1 antibody (AA 1077-1176)
-
- Target See all MAP3K1 Antibodies
- MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))
-
Binding Specificity
- AA 1077-1176
-
Reactivity
- Human
-
Host
- Mouse
-
Clonality
- Monoclonal
-
Conjugate
- This MAP3K1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Formalin-fixed Sections) (IHC (f))
- Specificity
- Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.
- Cross-Reactivity (Details)
- Human.
- Purification
- 1.0mg/ml of Ab purified from Bioreactor by Protein A/G.
- Immunogen
- Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
- Clone
- 2F6
- Isotype
- IgG2a kappa
- Top Product
- Discover our top product MAP3K1 Primary Antibody
-
-
- Application Notes
-
Known_Application: Western Blot (1-2 μg/mL),Immunohistochemistry (Formalin-fixed) (1-2 μg/mL for 30 minutes at RT)(Staining of formalin-fixed tissues requires heating tissue sections in 10 mM Tris Buffer with 1 mM EDTA, pH 9.0, for 45 min at 95°C followed by cooling at RT for 20 minutes)Optimal dilution for a specific application should be determined.
Positive_Control: A431, HeLa or HL-60 cells. Liver tissue.
- Restrictions
- For Research Use only
-
- Concentration
- 1.0 mg/mL
- Buffer
- Prepared in 10 mM PBS, WITHOUT BSA and Azide.
- Preservative
- Azide free
- Storage
- -20 °C,-80 °C
- Storage Comment
- Antibody without azide store at -20 to -80 °C. Antibody is stable for 24 months. Non-hazardous.
- Expiry Date
- 24 months
-
- Target
- MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))
- Alternative Name
- MAP3K1 (MAP3K1 Products)
- Synonyms
- MAP3K1 antibody, Mekk1 antibody, MAPKKK1 antibody, MEKK1 antibody, Mekk antibody, ARAKIN antibody, ATMEKK1 antibody, MAPK/ERK kinase kinase 1 antibody, MAPKKK8 antibody, T15F16.5 antibody, T15F16_5 antibody, MEKK antibody, MEKK 1 antibody, SRXY6 antibody, mitogen-activated protein kinase kinase kinase 1 antibody, mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase antibody, MAPK/ERK kinase kinase 1 antibody, MAP3K1 antibody, map3k1 antibody, Map3k1 antibody, MEKK1 antibody
- Background
-
MEKK1, MEK Kinase 1, MEKK, SRXY6, MAPKKK1,MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1)
Cellular localisation: Cytoplasmic - Molecular Weight
- 195kDa (intact), 80kDa (cleaved)
- Gene ID
- 4214, 653654
- UniProt
- Q13233
- Pathways
- MAPK Signaling, Interferon-gamma Pathway, Caspase Cascade in Apoptosis, TLR Signaling, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Regulation of Actin Filament Polymerization, Toll-Like Receptors Cascades
-