CD68 antibody (AA 27-282)
-
- Target See all CD68 Antibodies
- CD68 (CD68 Molecule (CD68))
-
Binding Specificity
- AA 27-282
-
Reactivity
- Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CD68 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunocytochemistry (ICC)
- Purpose
- Polyclonal Antibody to Scavenger Receptor Class D Member 1 (SCARD1)
- Specificity
- The antibody is a rabbit polyclonal antibody raised against SCARD1. It has been selected for its ability to recognize SCARD1 in immunohistochemical staining and western blotting.
- Purification
- Antigen-specific affinity chromatography followed by Protein A affinity chromatography
- Immunogen
- Recombinant Scavenger Receptor Class D Member 1 (SCARD1) corresdonding to Ala27~Pro282 plus TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA with N-terminal His and GST Tag
- Isotype
- IgG
- Top Product
- Discover our top product CD68 Primary Antibody
-
-
- Application Notes
-
Western blotting: 0.5-2 μg/mL
Immunohistochemistry: 5-20 μg/mL
Immunocytochemistry: 5-20 μg/mL
Optimal working dilutions must be determined by end user.
- Comment
-
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- 0.01M PBS, pH 7.4, containing 0.05 % Proclin-300, 50 % glycerol.
- Preservative
- ProClin
- Precaution of Use
- This product contains ProClin: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
- Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.
- Expiry Date
- 24 months
-
- Target
- CD68 (CD68 Molecule (CD68))
- Alternative Name
- Scavenger Receptor Class D Member 1 (CD68 Products)
- Synonyms
- Lamp4 antibody, Scard1 antibody, gp110 antibody, GP110 antibody, LAMP4 antibody, SCARD1 antibody, CD68 molecule antibody, CD68 antigen antibody, Cd68 molecule antibody, CD68 antibody, Cd68 antibody
- Background
- CD68, GP110, Macrosialin, Macrophage Antigen CD68
-