GRIA2 antibody (C-Term, Cytosolic) (FL490)

Catalog No. ABIN7595512

The FL490-conjugated Mouse Monoclonal anti-GRIA2 antibody (Clone L21-32) (ABIN7595512) specifically detects GRIA2 in IHC and ICC. The antibody is reactive with Rat samples.

Quick Overview for GRIA2 antibody (C-Term, Cytosolic) (FL490) (ABIN7595512)

Target: GRIA2 (Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2))

Reactivity: Rat

Host: Mouse

Clonality: Monoclonal

Conjugate: This GRIA2 antibody is conjugated to FL490

Application: Immunohistochemistry (IHC), Immunocytochemistry (ICC)

Grade: KO Validated

Clone: L21-32

Product Details anti-GRIA2 Antibody (FL490)

Binding Specificity: AA 834-883, C-Term, Cytosolic

Purpose: Anti-GluA2/GluR2 Glutamate Receptor Antibody FL490 Conjugate

Sequence: EFCYKSRAEA KRMKVAKNPQ NINPSSSQNS QNFATYKEGY NVYGIESVKI

Specificity: No off-targets reported for GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results)

Cross-Reactivity: Human, Mouse

Characteristics: Our Anti-GluA2/GluR2 glutamate receptor mouse monoclonal primary antibody is produced in-house from hybridoma clone L21/32. It is KO validated, detects human, mouse, and rat GluA2/GluR2 glutamate receptor, and is purified by protein a chromatography. It is great for use in IHC, ICC.

Purification: Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and conjugation of purified mAb. Purified mAbs are >90% specific antibody.

Purity: Purified mAbs are >90 % specific antibody.

Immunogen: Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli

Isotype: IgG1

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: PBS with 0.09 % azide7.4

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.

Expiry Date: 12 months

Target Details for GRIA2

Target: GRIA2 (Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2))

Alternative Name: GluA2

Background:

Synonyms: Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)

Description Logic: Our Anti-GluA2/GluR2 glutamate receptor mouse monoclonal primary antibody is produced from hybridoma clone L21/32. It is KO validated, detects human, mouse, and rat GluA2/GluR2 glutamate receptor, and is purified by protein a chromatography. It is great for use in IHC, ICC.

Gene Name Alternatives: Gria2 Glur2

Molecular Weight: 90 kDa

UniProt: P19491

Pathways: PI3K-Akt Signaling