CRB1 antibody

Catalog No. ABIN7880515

The Rabbit Polyclonal anti-CRB1 antibody (ABIN7880515) specifically detects CRB1 in WB, FACS and IHC (p). The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for CRB1 antibody (ABIN7880515)

Target: CRB1 (Crumbs Homolog 1 (CRB1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CRB1 antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-CRB1 Antibody

Purpose: CRB1 Antibody

Sequence: FRTRDANVII LHAEKEPEFL NISIQDSRLF FQLQ

Purification: Affinity purified

Immunogen: Amino acids FRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQ from the human protein were used as the immunogen for the CRB1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the CRB1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: Store the CRB1 antibody at -20oC.

Target Details for CRB1

Target: CRB1 (Crumbs Homolog 1 (CRB1))

Alternative Name: CRB1

Background: Crumbs homolog 1 is a protein that in humans is encoded by the CRB1 gene. This gene encodes a protein which is similar to the Drosophila crumbs protein and localizes to the inner segment of mammalian photoreceptors. In Drosophila crumbs localizes to the stalk of the fly photoreceptor and may be a component of the molecular scaffold that controls proper development of polarity in the eye. Mutations in this gene are associated with a severe form of retinitis pigmentosa, RP12, and with Leber congenital amaurosis. Alternate splicing results in multiple transcript variants, some protein coding and some non-protein coding.

UniProt: P82279

Pathways: Notch Signaling