HAS1 antibody

Catalog No. ABIN7881135

The Rabbit Polyclonal anti-HAS1 antibody is suitable to detect HAS1 in samples from Human, Mouse and Rat. It has been validated for WB, ICC, IF and IHC (p).

Quick Overview for HAS1 antibody (ABIN7881135)

Target: HAS1 (Hyaluronan Synthase 1 (HAS1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HAS1 antibody is un-conjugated

Application: Western Blotting (WB), Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-HAS1 Antibody

Purpose: HAS1 Antibody / Hyaluronan synthase 1

Sequence: NRAEDLYMVD MFREVFADED PATYVWDGNY HQPWEPA

Purification: Antigen affinity purified

Immunogen: Amino acids NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA were used as the immunogen for the HAS1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the HAS1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the HAS1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for HAS1

Target: HAS1 (Hyaluronan Synthase 1 (HAS1))

Alternative Name: HAS1

Background: Hyaluronan synthase 1 is an enzyme that in humans is encoded by the HAS1 gene. This gene is mapped to 19q13.41. Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide variety of organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternating glucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. It serves a variety of functions, including space filling, lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during wound healing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. AS1 is a member of the newly identified vertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homology to the hasA gene product of Streptococcus pyogenes, a glycosaminoglycan synthetase (DG42) from Xenopus laevis, and a recently described murine hyaluronan synthase.

UniProt: Q92839

Pathways: Glycosaminoglycan Metabolic Process