Isocitrate Dehydrogenase antibody

Catalog No. ABIN7881330

This Mouse Monoclonal antibody specifically detects Isocitrate Dehydrogenase in WB, IF and FACS. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for Isocitrate Dehydrogenase antibody (ABIN7881330)

Target: Isocitrate Dehydrogenase (IDH)

Reactivity: Human, Rat, Mouse

Host: Mouse

Clonality: Monoclonal

Conjugate: This Isocitrate Dehydrogenase antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS)

Clone: 16H7

Product Details anti-Isocitrate Dehydrogenase Antibody

Purpose: Isocitrate Dehydrogenase Antibody / IDH1

Sequence: KGLPNVQRSD YLNTFEFMDK LGENLKIKLA QAK

Purification: Affinity purified

Immunogen: Amino acids KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK from the human protein were used as the immunogen for the Isocitrate Dehydrogenase antibody.

Isotype: IgG1

Application Details

Application Notes: Optimal dilution of the Isocitrate Dehydrogenase antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the Isocitrate Dehydrogenase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for Isocitrate Dehydrogenase

Target: Isocitrate Dehydrogenase (IDH)

Alternative Name: Isocitrate Dehydrogenase

Background: Isocitrate dehydrogenase 1 (NADP+), soluble is an enzyme that in humans is encoded by the IDH1 gene. Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

UniProt: O75874