GADD34 antibody

Catalog No. ABIN7882079

The Rabbit Polyclonal anti-GADD34 antibody (ABIN7882079) specifically detects GADD34 in WB. The antibody is reactive with Human samples.

Quick Overview for GADD34 antibody (ABIN7882079)

Target: GADD34 (PPP1R15A) (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 15A (PPP1R15A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GADD34 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GADD34 Antibody

Purpose: GADD34 Antibody / PPP1R15A

Sequence: MAPGQAPHQA TPWRDAHPFF LLSPVMGLLS RAWSRLR

Purification: Antigen affinity purified

Immunogen: Amino acids MAPGQAPHQATPWRDAHPFFLLSPVMGLLSRAWSRLR were used as the immunogen for the GADD34 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the GADD34 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the GADD34 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for GADD34

Target: GADD34 (PPP1R15A) (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 15A (PPP1R15A))

Alternative Name: GADD34

Background: Protein phosphatase 1 regulatory subunit 15A also known as growth arrest and DNA damage-inducible protein GADD34 is a protein that in humans is encoded by the PPP1R15A gene.

UniProt: O75807

Pathways: ER-Nucleus Signaling, Unfolded Protein Response