WASF1 antibody

Catalog No. ABIN8115785

The Rabbit Polyclonal anti-WASF1 antibody is suitable to detect WASF1 in samples from Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Saccharomyces cerevisiae and Zebrafish (Danio rerio). It has been validated for IHC.

Quick Overview for WASF1 antibody (ABIN8115785)

Target: WASF1 (WAS Protein Family, Member 1 (WASF1))

Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Saccharomyces cerevisiae, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WASF1 antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-WASF1 Antibody

Purpose: WASF1 Antibody

Sequence: TPYRDDGKEG LKFYTNPSYF FDLWKEKMLQ DTEDKRKEKR KQKQKNLDRP

Predicted Reactivity: Cow: 100%, Dog: 100%, Guinea Pig: 100%, Horse: 100%, Human: 100%, Mouse: 100%, Rabbit: 100%, Rat: 100%, Yeast: 83%, Zebrafish: 92%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence TPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRP

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP63994-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for WASF1

Target: WASF1 (WAS Protein Family, Member 1 (WASF1))

Alternative Name: WASF1

Background:

Background Information: The protein encoded by this gene, a member of the Wiskott-Aldrich syndrome protein (WASP)-family, plays a critical role downstream of Rac, a Rho-family small GTPase, in regulating the actin cytoskeleton required for membrane ruffling. It has been shown to associate with an actin nucleation core Arp2/3 complex while enhancing actin polymerization in vitro. Wiskott-Aldrich syndrome is a disease of the immune system, likely due to defects in regulation of actin cytoskeleton. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.

Gene Name: WAS protein family, member 1

Alternative Symbols: WAVE, SCAR1, WAVE1, NEDALVS

Protein Name: Wiskott-Aldrich syndrome protein family member 1

Molecular Weight: 62 kDa

Gene ID: 8936

NCBI Accession: NP_003922

UniProt: Q92558

Pathways: RTK Signaling, Regulation of Actin Filament Polymerization