anti-Human PRAF2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended PRAF2 Antibody (supplied by: Log in to see )

PRA1 Domain Family, Member 2 (PRAF2) Antibodies
  • AA986329
  • C78013
  • DXImx39e
  • JM4
  • Sfc20
  • PRA1 domain family member 2
  • PRA1 domain family 2
  • PRAF2
  • Praf2
Human, Rat (Rattus)
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN4327933
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.5788965 ABIN5611638 EIA IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
7 ABIN2879126 ELISA IHC IHC (p) WB Rabbit IgG AA 129-178 Log in to see Polyclonal 0
7 ABIN265488 IF IHC (p) WB Rabbit Log in to see Polyclonal 0
7 ABIN5650156 IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
4 ABIN5961284 ELISA IF IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2879470 IF IHC IHC (p) WB Rabbit AA 141-190 Log in to see Polyclonal 0
1 ABIN2764401 ELISA IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN1736098 IHC (p) ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2963879 IF IHC (p) WB Rabbit AA 141-190, Leu166 Log in to see Polyclonal 0


Antigen PRA1 Domain Family, Member 2 (PRAF2) Antibodies
Reactivity Human, Rat (Rattus)
(28), (24), (22), (3), (3), (3)
Host Rabbit
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(26), (17), (16), (9), (7), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-PRAF2 Antibody

Target Details PRAF2 Application Details Handling References for anti-PRAF2 antibody (ABIN4327933) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINN
Isotype IgG
Plasmids, Primers & others

Target Details PRAF2

Product Details anti-PRAF2 Antibody Application Details Handling References for anti-PRAF2 antibody (ABIN4327933) Images back to top
Alternative Name JM4 (PRAF2 Antibody Abstract)
Background Gene Symbol: PRAF2
Gene ID 11230
Pathways Dicarboxylic Acid Transport

Application Details

Product Details anti-PRAF2 Antibody Target Details PRAF2 Handling References for anti-PRAF2 antibody (ABIN4327933) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-PRAF2 Antibody Target Details PRAF2 Application Details References for anti-PRAF2 antibody (ABIN4327933) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-PRAF2 antibody (ABIN4327933)

Product Details anti-PRAF2 Antibody Target Details PRAF2 Application Details Handling Images back to top
Product cited in:

Koomoa, Go, Wester, Bachmann: "Expression profile of PRAF2 in the human brain and enrichment in synaptic vesicles." in: Neuroscience letters, Vol. 436, Issue 2, pp. 171-6, 2008


Product Details anti-PRAF2 Antibody Target Details PRAF2 Application Details Handling References for anti-PRAF2 antibody (ABIN4327933) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PRA1 Domain Family, Member 2 (PRAF2) antibody (ABIN4327933) Immunohistochemistry-Paraffin: JM4 Antibody [NBP1-87886] - Staining of human cerebell...
Western Blotting (WB) image for anti-PRA1 Domain Family, Member 2 (PRAF2) antibody (ABIN4327933) Western Blot: JM4 Antibody [NBP1-87886] - Lane 1: NIH-3T3 cell lysate (Mouse embryoni...
Western Blotting (WB) image for anti-PRA1 Domain Family, Member 2 (PRAF2) antibody (ABIN4327933) Western Blot: JM4 Antibody [NBP1-87886] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PRA1 Domain Family, Member 2 (PRAF2) antibody (ABIN4327933) Immunohistochemistry-Paraffin: JM4 Antibody - Staining of human skeletal muscle show...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PRA1 Domain Family, Member 2 (PRAF2) antibody (ABIN4327933) Immunohistochemistry-Paraffin: JM4 Antibody - Staining in human cerebral cortex and ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PRA1 Domain Family, Member 2 (PRAF2) antibody (ABIN4327933) Immunohistochemistry-Paraffin: JM4 Antibody - Staining of human cerebral cortex show...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PRA1 Domain Family, Member 2 (PRAF2) antibody (ABIN4327933) Immunohistochemistry-Paraffin: JM4 Antibody - Staining of human testis shows moderat...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PRA1 Domain Family, Member 2 (PRAF2) antibody (ABIN4327933) Immunohistochemistry-Paraffin: JM4 Antibody - Staining of human cerebellum shows mod...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PRA1 Domain Family, Member 2 (PRAF2) antibody (ABIN4327933) Immunohistochemistry-Paraffin: JM4 Antibody - Staining of human skeletal muscle show...