anti-Mouse (Murine) COPA antibody for Western Blotting

Recommended COPA Antibody (supplied by: Log in to see )

Antigen
Coatomer Protein Complex, Subunit alpha (COPA) Antibodies
  • COPA
  • DDBDRAFT_0189693
  • DDBDRAFT_0233797
  • DDB_0189693
  • DDB_0233797
  • DKFZp469O221
  • AU040324
  • xenin
  • HEP-COP
  • cb281
  • fb13c12
  • wu:fb13c12
  • coatomer protein complex subunit alpha
  • WD40 repeat-containing protein
  • Coatomer subunit alpha
  • coatomer protein complex, subunit alpha
  • coatomer protein complex subunit alpha L homeolog
  • COPA
  • copA
  • cgd8_860
  • Chro.80105
  • AFUA_3G08840
  • copa
  • Copa
  • copa.L
Epitope
N-Term
3
2
2
1
1
1
1
1
Reactivity
Human, Mouse (Murine)
24
9
8
7
6
6
6
6
5
5
5
5
4
4
4
1
1
1
Host
Rabbit
14
9
1
Clonality
Polyclonal
Conjugate
This COPA antibody is un-conjugated
1
1
1
1
1
1
Application
Western Blotting (WB)
23
15
3
2
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN634777
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
17.063175 ABIN634778 WB Rabbit Middle Region Log in to see Polyclonal 0
9.306385 ABIN2784677 WB Rabbit N-Term Log in to see Polyclonal 3
7 ABIN337288 ICC IHC IHC (p) WB Rabbit IgG AA 1-19 Log in to see Polyclonal 0
4.8063846 ABIN2784678 WB Rabbit Middle Region Log in to see Polyclonal 1
4.8063846 ABIN2463478 ELISA WB Rabbit Log in to see Polyclonal 0
4.8063846 ABIN2561950 ELISA WB Goat IgG Internal Region Log in to see Polyclonal 0
4 ABIN321894 WB Rabbit IgG AA 22-71 Log in to see Polyclonal 0
4 ABIN469430 WB Rabbit AA 396-445 Log in to see Polyclonal 0
1 ABIN2740049 ICC IF WB Rabbit IgG AA 1-19 Log in to see Polyclonal 0

General

Antigen Coatomer Protein Complex, Subunit alpha (COPA) Antibodies
Epitope N-Term
(3), (2), (2), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine)
(24), (9), (8), (7), (6), (6), (6), (6), (5), (5), (5), (5), (4), (4), (4), (1), (1), (1)
Host Rabbit
(14), (9), (1)
Clonality
Polyclonal
Conjugate This COPA antibody is un-conjugated
(1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(23), (15), (3), (2), (1), (1)
Supplier Log in to see

Product Details anti-COPA Antibody

Target Details COPA Application Details Handling Images
Specificity COPA antibody was raised against the N terminal of COPA
Purification Affinity purified
Immunogen COPA antibody was raised using the N terminal of COPA corresponding to a region with amino acids PWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGD
Plasmids, Primers & others

Target Details COPA

Product Details anti-COPA Antibody Application Details Handling Images back to top
Antigen
Alternative Name COPA (COPA Antibody Abstract)
Background In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). The alpha-COP, encoded by COPA, shares high sequence similarity with RET1P, the alpha subunit of the coatomer complex in yeast. Also, the N-terminal 25 amino acids of alpha-COP encode the bioactive peptide, xenin, which stimulates exocrine pancreatic secretion and may act as a gastrointestinal hormone.
Molecular Weight 135 kDa (MW of target protein)
Pathways Hormone Activity

Application Details

Product Details anti-COPA Antibody Target Details COPA Handling Images back to top
Application Notes WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.
Comment

COPA Blocking Peptide, catalog no. 33R-7432, is also available for use as a blocking control in assays to test for specificity of this COPA antibody

Restrictions For Research Use only

Handling

Product Details anti-COPA Antibody Target Details COPA Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPA antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product Details anti-COPA Antibody Target Details COPA Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Coatomer Protein Complex, Subunit alpha (COPA) (N-Term) antibody (ABIN634777) COPA antibody used at 0.5 ug/ml to detect target protein.