anti-Human Relaxin 3 antibody for Immunohistochemistry

Recommended Relaxin 3 Antibody (supplied by: Log in to see )

Relaxin 3 (RLN3) Antibodies
  • RFLB
  • RLX3
  • RFLC2
  • rln3
  • rlx 3a
  • rlx3a
  • rxn3
  • insl7
  • zins4
  • H3
  • RXN3
  • ZINS4
  • M3
  • Insl7
  • Relaxin-3
  • relaxin 3
  • relaxin 3a
  • RLN3
  • rln3a
  • rln3
  • Rln3
This Relaxin 3 antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4349932
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.673489 ABIN2872412 IHC Rabbit Chain B Log in to see Polyclonal 0
1 ABIN4349931 ELISA IF IHC IHC (p) WB Rabbit Center Log in to see Polyclonal 0
1 ABIN1830432 IHC WB Goat IgG AA 27-142 Log in to see Polyclonal 0
1 ABIN3180853 ELISA IHC Rabbit IgG Internal Region Log in to see Polyclonal 0
1 ABIN2349972 IHC WB Goat IgG AA 27-142 Log in to see Polyclonal 0
1 ABIN6099156 ELISA IHC Rabbit IgG Internal Region Log in to see Polyclonal 0
1 ABIN2872420 IHC Rabbit Log in to see Polyclonal 0


Antigen Relaxin 3 (RLN3) Antibodies
Reactivity Human
(52), (5), (3)
Host Rabbit
(37), (18), (2)
Conjugate This Relaxin 3 antibody is un-conjugated
(6), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(35), (21), (12), (4), (4), (4), (4), (2), (1), (1)
Supplier Log in to see

Product Details anti-Relaxin 3 Antibody

Target Details Relaxin 3 Application Details Handling Images
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LALTKSPQAFYRGRPSWQGTPGVLRGSRDVLAGLSSSCCKWGCSKSEISSLC
Isotype IgG
Plasmids, Primers & others

Target Details Relaxin 3

Product Details anti-Relaxin 3 Antibody Application Details Handling Images back to top
Alternative Name Relaxin-3 (RLN3 Antibody Abstract)
Background Gene Symbol: RLN3
Gene ID 117579
Pathways Hormone Activity, cAMP Metabolic Process

Application Details

Product Details anti-Relaxin 3 Antibody Target Details Relaxin 3 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-Relaxin 3 Antibody Target Details Relaxin 3 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-Relaxin 3 Antibody Target Details Relaxin 3 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Relaxin 3 (RLN3) antibody (ABIN4349932) Immunohistochemistry: Relaxin-3 Antibody [NBP2-47308] - Analysis of human testis show...
Western Blotting (WB) image for anti-Relaxin 3 (RLN3) antibody (ABIN4349932) Western Blot: Relaxin-3 Antibody [NBP2-47308] - Lane 1: Marker [kDa] 250, 130, 95, 72...
Western Blotting (WB) image for anti-Relaxin 3 (RLN3) antibody (ABIN4349932) Western Blot: Relaxin-3 Antibody - Analysis in control (vector only transfected HEK2...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Relaxin 3 (RLN3) antibody (ABIN4349932) Immunohistochemistry-Paraffin: Relaxin-3 Antibody - Staining of human testis shows m...