anti-Human Post-GPI Attachment To Proteins 3 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Post-GPI Attachment To Proteins 3 Antibody (supplied by: Log in to see )

Post-GPI Attachment To Proteins 3 (PGAP3) Antibodies
  • GB10206
  • AGLA546
  • CAB2
  • PER1
  • PERLD1
  • PP1498
  • D430035D22Rik
  • Perld1
  • perld1
  • pgap3
  • post-GPI attachment to proteins factor 3
  • post-GPI attachment to proteins 3
  • post-GPI attachment to proteins 3 L homeolog
  • LOC412085
  • PGAP3
  • Pgap3
  • pgap3.L
  • pgap3
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4345031
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN657161 IHC (p) WB Rabbit Ig Fraction AA 141-169, Center Log in to see Polyclonal
1 ABIN5537303 IHC (p) WB Rabbit Ig Fraction AA 141-169 Log in to see Polyclonal
1 ABIN5585544 IHC (p) Rabbit IgG Log in to see Polyclonal
1 ABIN1810949 IHC (p) WB Rabbit AA 141-169 Log in to see Polyclonal


Antigen Post-GPI Attachment To Proteins 3 (PGAP3) Antibodies
Reactivity Human
(42), (5), (4), (4), (3), (3), (3), (2), (2), (2), (1), (1)
Host Rabbit
Conjugate Un-conjugated
(6), (6), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(40), (27), (21), (12), (12), (4)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAGWTCRDDCKYECMWVTVGLYLQEGHKVPQFHGKWP
Isotype IgG

Target Details

Product details Application Details Handling Images back to top
Alternative Name PGAP3 (PGAP3 Antibody Abstract)
Background Gene Symbol: PGAP3
Gene ID 93210
Research Area Organelles
Pathways Inositol Metabolic Process

Application Details

Product details Target Details Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product details Target Details Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product details Target Details Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Post-GPI Attachment To Proteins 3 (PGAP3) antibody (ABIN4345031) Immunohistochemistry-Paraffin: PGAP3 Antibody [NBP1-86692] - Staining of human duoden...
Immunofluorescence (IF) image for anti-Post-GPI Attachment To Proteins 3 (PGAP3) antibody (ABIN4345031) Immunocytochemistry/Immunofluorescence: PGAP3 Antibody [NBP1-86692] - Immunofluoresce...