anti-Human IL21 antibody for Immunocytochemistry

Recommended IL21 Antibody (supplied by: Log in to see )

Antigen
Interleukin 21 (IL21) Antibodies
  • IL-21
  • Za11
  • interleukin 21
  • IL21
  • Il21
Epitope
AA 71-102
16
15
12
9
8
8
7
6
6
5
4
3
3
3
3
2
2
2
2
2
2
1
1
1
1
1
1
1
Reactivity
Human
202
99
28
8
4
3
3
1
1
Host
Goat
172
69
32
8
4
Clonality
Polyclonal
Conjugate
This IL21 antibody is un-conjugated
24
12
12
10
10
8
6
5
4
4
3
3
3
3
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunohistochemistry (IHC), ELISA
193
131
48
41
29
23
14
13
10
7
6
6
4
4
4
3
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN342791
$ 683.83
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN6257277 ELISA ICC IF WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN4324904 ELISA ICC IF WB Rabbit all Isoforms Log in to see Polyclonal 0
1 ABIN4324913 ICC IF IHC WB Mouse IgG1 kappa Log in to see 14k5H3 1
1 ABIN1002621 ICC ELISA WB Rabbit IgG Internal Region Log in to see Polyclonal 3
1 ABIN1174928 ICC IHC WB Rabbit IgG AA 23-155 Log in to see Polyclonal 0
1 ABIN342764 ICC ELISA Goat AA 33-61 Log in to see Polyclonal 0
1 ABIN5627170 ELISA ICC IF WB Rabbit IgG all Isoforms Log in to see Polyclonal 0
1 ABIN1030955 ICC ELISA WB Rabbit Middle Region Log in to see Polyclonal 0
1 ABIN1868629 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN4225396 ICC IF IHC WB Alexa Fluor 488 Mouse IgG1 kappa Log in to see 14k5H3 0
1 ABIN4225398 ICC IF IHC WB Alexa Fluor 700 Mouse IgG1 kappa Log in to see 14k5H3 0
1 ABIN4225374 ICC IF IHC WB DyLight 755 Mouse IgG1 kappa Log in to see 14k5H3 0
1 ABIN4225377 ICC IF IHC WB DyLight 550 Mouse IgG1 kappa Log in to see 14k5H3 0
1 ABIN4225372 ICC IF IHC WB DyLight 488 Mouse IgG1 kappa Log in to see 14k5H3 0
1 ABIN4324912 ICC IF IHC WB Mouse IgG1 kappa Log in to see 14k5H3 0
1 ABIN1174931 ICC IF IHC WB FITC Rabbit IgG Log in to see Polyclonal 0
1 ABIN2959771 ICC ELISA WB Rabbit IgG Center Log in to see Polyclonal 0
1 ABIN1887779 ICC ELISA WB Rabbit Center Log in to see Polyclonal 0
1 ABIN4225397 ICC IF IHC WB Alexa Fluor 647 Mouse IgG1 kappa Log in to see 14k5H3 0
1 ABIN4225371 ICC IF IHC WB DyLight 680 Mouse IgG1 kappa Log in to see 14k5H3 0

General

Antigen Interleukin 21 (IL21) Antibodies
Epitope AA 71-102
(16), (15), (12), (9), (8), (8), (7), (6), (6), (5), (4), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human
(202), (99), (28), (8), (4), (3), (3), (1), (1)
Host Goat
(172), (69), (32), (8), (4)
Clonality
Polyclonal
Conjugate This IL21 antibody is un-conjugated
(24), (12), (12), (10), (10), (8), (6), (5), (4), (4), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunohistochemistry (IHC), ELISA
(193), (131), (48), (41), (29), (23), (14), (13), (10), (7), (6), (6), (4), (4), (4), (3), (2), (1), (1)
Supplier Log in to see

Product Details anti-IL21 Antibody

Target Details IL21 Application Details Handling Images
Specificity Peptide sequence is <50 % identical to other interleukins in this region. The antibody recognizes human IL-21.
Predicted Reactivity Percent identity by BLAST analysis: Human, Gorilla (100%) Gibbon, Marmoset (97%) Monkey (94%).
Purification Immunoaffinity purified
Immunogen Synthetic peptide 78CFQKAQLKSANTGNNERIINVSIKKLKRKPPS109 corresponding to N-terminus region of human IL-21. Percent identity by BLAST analysis: Human, Gorilla (100%), Gibbon, Marmoset (97%), Monkey (94%).

Type of Immunogen: Synthetic peptide
Plasmids, Primers & others

Target Details IL21

Product Details anti-IL21 Antibody Application Details Handling Images back to top
Antigen
Alternative Name IL21 (IL21 Antibody Abstract)
Background Name/Gene ID: IL21
Family: Interleukin

Synonyms: IL21, Interleukin 21, Interleukin-21, Interleukin-21 isoform, Za11, IL-21
Gene ID 59067
UniProt Q9GZX6
Pathways JAK-STAT Signaling, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response

Application Details

Product Details anti-IL21 Antibody Target Details IL21 Handling Images back to top
Application Notes Approved: ELISA (1:100000), ICC, IHC
Comment

Target Species of Antibody: Human

Restrictions For Research Use only

Handling

Product Details anti-IL21 Antibody Target Details IL21 Application Details Images back to top
Format Liquid
Concentration Lot specific
Buffer Phosphate buffered saline, 0.1 % sodium azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid freeze-thaw cycles.
Storage -20 °C,-80 °C
Storage Comment Short term: -20°C
Long term: -70°C
Avoid freeze-thaw cycles.

Images

Product Details anti-IL21 Antibody Target Details IL21 Application Details Handling back to top
Supplier Images
 image for anti-Interleukin 21 (IL21) (AA 71-102) antibody (ABIN342791) anti-Interleukin 21 (IL21) (AA 71-102) antibody