anti-Rat (Rattus) IL7R antibody for Western Blotting

Recommended IL7R Antibody (supplied by: Log in to see )

Antigen
Interleukin 7 Receptor (IL7R) Antibodies
  • IL7R
  • CD127
  • IL-7Ralpha
  • CDW127
  • IL-7R-alpha
  • IL7RA
  • ILRA
  • IL-7RA
  • interleukin 7 receptor
  • IL7R
  • Il7r
Epitope
AA 278-315, C-Term
28
28
15
15
13
9
8
7
7
6
6
5
4
3
3
3
3
2
2
2
1
1
1
1
1
1
1
Reactivity
Human, Rat (Rattus)
237
207
47
5
2
2
1
Host
Rabbit
143
138
92
17
7
4
1
Clonality
Polyclonal
Conjugate
This IL7R antibody is un-conjugated
30
28
24
19
16
14
12
8
7
7
7
6
6
5
5
5
4
3
3
3
3
3
3
3
2
2
2
2
2
2
2
2
2
2
1
1
Application
Western Blotting (WB)
180
175
82
73
45
26
20
12
12
11
9
8
5
4
3
3
2
2
2
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4886632
$ 240.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
3.080771 ABIN2957844 WB Rabbit C-Term Log in to see Polyclonal 0
3.080771 ABIN4899575 CyTOF FACS WB Sheep IgG AA 21-239 Log in to see Polyclonal 0
3.080771 ABIN1862791 ICC IHC WB Rabbit IgG AA 1-239 Log in to see Polyclonal 0
3.080771 ABIN801438 IF (p) IHC (p) WB Rabbit IgG AA 440-451, pTyr449 Log in to see Polyclonal 0
3.080771 ABIN259910 ELISA IHC IP WB Rabbit pTyr449 Log in to see Polyclonal 0
3.080771 ABIN5663842 IHC WB Rabbit IgG Log in to see Polyclonal 0
3.080771 ABIN2561663 ELISA WB Goat IgG Internal Region Log in to see Polyclonal 0
3.080771 ABIN6000346 IF/ICC IHC IP WB Rabbit AA 1-239 Log in to see Polyclonal 0
1 ABIN793354 ELISA WB Goat AA 36-47 Log in to see Polyclonal 0
1 ABIN351553 ELISA IHC IHC (p) WB Rabbit pTyr449 Log in to see Polyclonal 0
1 ABIN351552 ELISA IHC IHC (p) WB Rabbit C-Term Log in to see Polyclonal 0
1 ABIN372989 EIA IHC (p) WB Rabbit pTyr449 Log in to see Polyclonal 0
1 ABIN6262569 ELISA ICC IF IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5551826 EIA WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN5551827 EIA WB Rabbit IgG pTyr449 Log in to see Polyclonal 0
1 ABIN801447 IHC (p) WB HRP Rabbit IgG AA 440-451, pTyr449 Log in to see Polyclonal 0
1 ABIN4904051 ICC IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN596100 ELISA WB Sheep IgG Extracellular Domain Log in to see Polyclonal 0
1 ABIN801440 IHC (p) WB Biotin Rabbit IgG AA 440-451, pTyr449 Log in to see Polyclonal 0
1 ABIN2289703 ELISA WB Sheep IgG Log in to see Polyclonal 0

General

Antigen Interleukin 7 Receptor (IL7R) Antibodies
Epitope AA 278-315, C-Term
(28), (28), (15), (15), (13), (9), (8), (7), (7), (6), (6), (5), (4), (3), (3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Rat (Rattus)
(237), (207), (47), (5), (2), (2), (1)
Host Rabbit
(143), (138), (92), (17), (7), (4), (1)
Clonality
Polyclonal
Conjugate This IL7R antibody is un-conjugated
(30), (28), (24), (19), (16), (14), (12), (8), (7), (7), (7), (6), (6), (5), (5), (5), (4), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1)
Application Western Blotting (WB)
(180), (175), (82), (73), (45), (26), (20), (12), (12), (11), (9), (8), (5), (4), (3), (3), (2), (2), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-IL7R Antibody

Target Details IL7R Application Details Handling Images
Purpose Rabbit IgG polyclonal antibody for Interleukin-7 receptor subunit alpha(IL7R) detection. Tested with WB in Human,Rat.
Sequence DHKKTLEHLC KKPRKNLNVS FNPESFLDCQ IHRVDDIQ
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Interleukin-7 receptor subunit alpha(IL7R) detection. Tested with WB in Human,Rat.
Gene Name: interleukin 7 receptor
Protein Name: Interleukin-7 receptor subunit alpha
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ), different from the related mouse sequence by nine amino acids.
Isotype IgG
Plasmids, Primers & others

Target Details IL7R

Product Details anti-IL7R Antibody Application Details Handling Images back to top
Antigen
Alternative Name IL7R (IL7R Antibody Abstract)
Background The interleukin-7 receptor, also known as IL7R alpha, is a protein found on the surface of cells. It is mapped to 5p13. Interleukin-7 receptor has been shown to play a critical role in the development of immune cells called lymphocytes - specifically in a process known as V(D)J recombination. This protein is also found to control the accessibility of a region of the genome that contains the T-cell receptor gamma gene, by STAT5 and histone acetylation. Knockout studies in mice suggest that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. Functional defects in this protein may be associated with the pathogenesis of severe combined immunodeficiency (SCID).

Synonyms: CD 127 | CD127 | CD127 antigen | IL 7R alpha | IL-7R-alpha | IL 7R | IL7R | IL-7RA | IL7RA | IL7Ralpha | ILRA | Interleukin 7 receptor | P16871
Gene ID 3575
UniProt P16871
Pathways JAK-STAT Signaling, Regulation of Leukocyte Mediated Immunity, Production of Molecular Mediator of Immune Response, Regulation of Cell Size

Application Details

Product Details anti-IL7R Antibody Target Details IL7R Handling Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.
Comment

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions For Research Use only

Handling

Product Details anti-IL7R Antibody Target Details IL7R Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Images

Product Details anti-IL7R Antibody Target Details IL7R Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Interleukin 7 Receptor (IL7R) (AA 278-315), (C-Term) antibody (ABIN4886632) Western blot analysis of IL7R alpha expression in 22RV1 whole cell lysates ( Lane 1)....