anti-Human MXI1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended MXI1 Antibody

Antigen
MAX Interactor 1 (MXI1) Antibodies
  • mxi
  • mad2
  • mxd2
  • xmxi1
  • MGC89544
  • MXI1
  • etID309773.22
  • fb16b12
  • fb55f03
  • wu:fb16b12
  • wu:fb55f03
  • wu:fd06a08
  • wu:fz74f10
  • ENSMUSG00000067085
  • Gm10197
  • Mad2
  • bHLHc11
  • MXI-WR
  • MAD2
  • MXD2
  • MXI
  • MAX interactor 1, dimerization protein
  • max interactor 1, dimerization protein
  • MAX interactor 1, dimerization protein L homeolog
  • mxi1
  • MXI1
  • Mxi1
  • mxi1.L
Reactivity
Human
52
43
23
6
5
5
4
4
3
2
2
2
2
2
1
Host
Rabbit
53
10
3
Clonality
Polyclonal
Conjugate
This MXI1 antibody is un-conjugated
4
3
3
2
2
2
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
51
28
7
5
3
3
2
1
1
1
Options

Available images

Catalog No. ABIN4336867
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Clonality References Details
8.86096 ABIN6756536 IHC IHC (p) WB Rabbit N-Term Polyclonal 0
7 ABIN5584024 IHC (p) WB Rabbit Polyclonal 0
4 ABIN6749696 IHC IHC (p) WB Rabbit IgG AA 176-225 Polyclonal 0

General

Antigen MAX Interactor 1 (MXI1) Antibodies
Reactivity Human
(52), (43), (23), (6), (5), (5), (4), (4), (3), (2), (2), (2), (2), (2), (1)
Host Rabbit
(53), (10), (3)
Clonality
Polyclonal
Conjugate This MXI1 antibody is un-conjugated
(4), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(51), (28), (7), (5), (3), (3), (2), (1), (1), (1)
Supplier

Product Details anti-MXI1 Antibody

Target Details MXI1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HTTLGLLNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRM
Isotype IgG
Plasmids, Primers & others

Target Details MXI1

Product Details anti-MXI1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name Mxi1 (MXI1 Antibody Abstract)
Background Gene Symbol: MXI1
Gene ID 4601
Pathways Maintenance of Protein Location

Application Details

Product Details anti-MXI1 Antibody Target Details MXI1 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-MXI1 Antibody Target Details MXI1 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-MXI1 Antibody Target Details MXI1 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-MAX Interactor 1 (MXI1) antibody (ABIN4336867) Western Blot: Mxi1 Antibody [NBP1-88626] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-MAX Interactor 1 (MXI1) antibody (ABIN4336867) Immunohistochemistry-Paraffin: Mxi1 Antibody - Staining of human colon shows strong ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-MAX Interactor 1 (MXI1) antibody (ABIN4336867) Immunohistochemistry-Paraffin: Mxi1 Antibody - Staining of human skin shows moderate...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-MAX Interactor 1 (MXI1) antibody (ABIN4336867) Immunohistochemistry-Paraffin: Mxi1 Antibody - Staining of human testis shows modera...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-MAX Interactor 1 (MXI1) antibody (ABIN4336867) Immunohistochemistry-Paraffin: Mxi1 Antibody - Staining of human cerebral cortex sho...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-MAX Interactor 1 (MXI1) antibody (ABIN4336867) Immunohistochemistry-Paraffin: Mxi1 Antibody - Staining of human cerebral cortex sho...
Western Blotting (WB) image for anti-MAX Interactor 1 (MXI1) antibody (ABIN4336867) Western Blot: Mxi1 Antibody - Analysis in control (vector only transfected HEK293T l...