anti-Rat (Rattus) RPS6KA1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended RPS6KA1 Antibody (supplied by: Log in to see )

Antigen
Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 1 (RPS6KA1) Antibodies
  • HU-1
  • MAPKAPK1A
  • RSK
  • RSK1
  • Rsk1
  • p90rsk
  • rsk
  • RPS6KA
  • hu-1
  • mapkapk1a
  • rsk1
  • wu:fc56h07
  • zgc:152654
  • ribosomal protein S6 kinase A1
  • ribosomal protein S6 kinase polypeptide 1
  • ribosomal protein S6 kinase A1-like
  • ribosomal protein S6 kinase A1 L homeolog
  • ribosomal protein S6 kinase a, polypeptide 1
  • RPS6KA1
  • Rps6ka1
  • RPS6KA1L
  • rps6ka1.L
  • rps6ka1
Reactivity
Human, Rat (Rattus)
406
229
196
51
13
8
8
6
6
4
4
2
2
1
1
1
1
Host
Rabbit
405
40
Clonality
Polyclonal
Conjugate
This RPS6KA1 antibody is un-conjugated
23
22
20
13
13
13
6
6
5
5
5
5
5
5
4
4
4
2
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
339
204
127
71
62
61
60
51
26
21
6
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4351278
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
10.879798 ABIN5947487 ICC IF IHC IHC (p) IP WB Rabbit IgG Log in to see SU03-65 0
10.879798 ABIN498221 IF IHC (p) WB Rabbit Log in to see Polyclonal 0
10.879798 ABIN713156 IF (p) IHC (p) WB Rabbit IgG pThr348 Log in to see Polyclonal 0
10.879798 ABIN4351274 IHC IHC (p) WB Rabbit Log in to see Polyclonal 0
1 ABIN196796 IF IHC (p) WB Rabbit pThr348 Log in to see Polyclonal 3
1 ABIN2878974 ELISA IHC IHC (p) WB Rabbit IgG AA 346-395 Log in to see Polyclonal 0
1 ABIN271934 IHC (p) WB Rabbit Log in to see Polyclonal 0
1 ABIN271935 IHC (p) WB Rabbit Log in to see Polyclonal 0
1 ABIN446802 ICC IF IHC (p) IHC WB Rabbit Log in to see Polyclonal 0
1 ABIN1738948 IHC (p) ELISA WB Rabbit IgG Internal Region Log in to see Polyclonal 0
1 ABIN6284353 ELISA IF IHC (p) WB Rabbit IgG AA 510-590 Log in to see Polyclonal 0
1 ABIN6287968 ELISA IHC (p) WB Rabbit IgG AA 300-380, pSer363, pThr359 Log in to see Polyclonal 0
1 ABIN6287989 ELISA IHC (p) WB Rabbit IgG AA 320-400, pSer380 Log in to see Polyclonal 0
1 ABIN6288219 ELISA IF IHC (p) WB Rabbit IgG AA 510-590, pThr573 Log in to see Polyclonal 0
1 ABIN6283314 ELISA IHC (p) WB Rabbit IgG AA 320-400 Log in to see Polyclonal 0
1 ABIN6283209 ELISA IHC (p) WB Rabbit IgG AA 300-380 Log in to see Polyclonal 0
1 ABIN713150 IHC (p) WB HRP Rabbit IgG pThr359 Log in to see Polyclonal 0
1 ABIN713165 IHC (p) WB HRP Rabbit IgG pThr348 Log in to see Polyclonal 0
1 ABIN713180 IHC (p) WB HRP Rabbit IgG pSer363 Log in to see Polyclonal 0
1 ABIN713195 IHC (p) WB HRP Rabbit IgG pSer352 Log in to see Polyclonal 0

General

Antigen Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 1 (RPS6KA1) Antibodies
Reactivity Human, Rat (Rattus)
(406), (229), (196), (51), (13), (8), (8), (6), (6), (4), (4), (2), (2), (1), (1), (1), (1)
Host Rabbit
(405), (40)
Clonality
Polyclonal
Conjugate This RPS6KA1 antibody is un-conjugated
(23), (22), (20), (13), (13), (13), (6), (6), (5), (5), (5), (5), (5), (5), (4), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(339), (204), (127), (71), (62), (61), (60), (51), (26), (21), (6), (2), (1), (1)
Supplier Log in to see

Product Details anti-RPS6KA1 Antibody

Target Details RPS6KA1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL
Isotype IgG
Plasmids, Primers & others

Target Details RPS6KA1

Product Details anti-RPS6KA1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name RSK1 (RPS6KA1 Antibody Abstract)
Background Gene Symbol: RPS6KA1
Gene ID 6195
Pathways MAPK Signaling, Neurotrophin Signaling Pathway, Activation of Innate immune Response, Toll-Like Receptors Cascades

Application Details

Product Details anti-RPS6KA1 Antibody Target Details RPS6KA1 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50, ImmunofluorescenceFor IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-RPS6KA1 Antibody Target Details RPS6KA1 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-RPS6KA1 Antibody Target Details RPS6KA1 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 1 (RPS6KA1) antibody (ABIN4351278) Western Blot: RSK1 Antibody [NBP1-89647] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 1 (RPS6KA1) antibody (ABIN4351278) Immunohistochemistry-Paraffin: RSK1 Antibody [NBP1-89647] - Immunohistochemical stain...
Immunofluorescence (IF) image for anti-Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 1 (RPS6KA1) antibody (ABIN4351278) Immunofluorescence: RSK1 Antibody [NBP1-89647] - Immunofluorescent staining of human ...
Western Blotting (WB) image for anti-Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 1 (RPS6KA1) antibody (ABIN4351278) Western Blot: RSK1 Antibody [NBP1-89647] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 1 (RPS6KA1) antibody (ABIN4351278) Immunohistochemistry-Paraffin: RSK1 Antibody - Staining of human skeletal muscle sho...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 1 (RPS6KA1) antibody (ABIN4351278) Immunohistochemistry-Paraffin: RSK1 Antibody - Staining in human small intestine and...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 1 (RPS6KA1) antibody (ABIN4351278) Immunohistochemistry-Paraffin: RSK1 Antibody - Staining of human small intestine sho...