anti-Human ELL3 antibody for Immunohistochemistry

Recommended ELL3 Antibody (supplied by: Log in to see )

Antigen
Elongation Factor RNA Polymerase II-Like 3 (ELL3) Antibodies
  • DKFZp469F0639
  • A930015D22Rik
  • elongation factor for RNA polymerase II 3
  • elongation factor RNA polymerase II-like 3 L homeolog
  • elongation factor RNA polymerase II-like 3
  • ELL3
  • ell3.L
  • Ell3
Reactivity
Human
44
19
16
1
1
1
1
1
Host
Rabbit
38
6
Clonality
Polyclonal
Conjugate
This ELL3 antibody is un-conjugated
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
32
15
13
3
Options
Supplier
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN4307756
Contact our Customer Service for availability and price in your country.

General

Antigen Elongation Factor RNA Polymerase II-Like 3 (ELL3) Antibodies
Reactivity Human
(44), (19), (16), (1), (1), (1), (1), (1)
Host Rabbit
(38), (6)
Clonality
Polyclonal
Conjugate This ELL3 antibody is un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(32), (15), (13), (3)
Supplier Log in to see

Product Details anti-ELL3 Antibody

Target Details ELL3 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HRGYLRLPGPGWSCLFSFIVSQCCQEGAGGSLDLVCQRFLRSGPNSLHCLGSLRERLIIWAAMDSIPAPSSVQGHNLTEDARHPESWQNTGGYSEGDAVSQPQMALEEVSVSDPLASN
Isotype IgG
Plasmids, Primers & others

Target Details ELL3

Product Details anti-ELL3 Antibody Application Details Handling Images back to top
Antigen
Alternative Name ELL3 (ELL3 Antibody Abstract)
Background Gene Symbol: ELL3
Gene ID 80237
Pathways Negative Regulation of intrinsic apoptotic Signaling

Application Details

Product Details anti-ELL3 Antibody Target Details ELL3 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-ELL3 Antibody Target Details ELL3 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-ELL3 Antibody Target Details ELL3 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Elongation Factor RNA Polymerase II-Like 3 (ELL3) antibody (ABIN4307756) Immunocytochemistry/Immunofluorescence: ELL3 Antibody [NBP1-82116] Staining of human ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Elongation Factor RNA Polymerase II-Like 3 (ELL3) antibody (ABIN4307756) Immunohistochemistry-Paraffin: ELL3 Antibody [NBP1-82116] - Staining of human stomach...