anti-Human Neural Precursor Cell Expressed, Developmentally Down-Regulated 4-Like antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Neural Precursor Cell Expressed, Developmentally Down-Regulated 4-Like Antibody (supplied by: Log in to see )

Neural Precursor Cell Expressed, Developmentally Down-Regulated 4-Like (NEDD4L) Antibodies
  • NEDD4-2
  • NEDD4.2
  • RSP5
  • hNEDD4-2
  • nedd4
  • nedd4-2
  • NEDD4
  • Nedd4-2
  • 1300012C07Rik
  • Nedd4b
  • neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase
  • NEDD4L
  • neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase S homeolog
  • neural precursor cell expressed, developmentally down-regulated gene 4-like
  • NEDD4L
  • LOC776799
  • nedd4l.S
  • Nedd4l
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4338490
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN744257 IHC (p) WB HRP Rabbit IgG pSer342 Log in to see Polyclonal
1 ABIN744250 IHC (p) WB Biotin Rabbit IgG pSer342 Log in to see Polyclonal
1 ABIN744248 IF (p) IHC (p) WB Rabbit IgG pSer342 Log in to see Polyclonal
1 ABIN2625989 IF IHC (p) IP WB Rabbit IgG AA 225-275 Log in to see Polyclonal
1 ABIN2625990 IF IHC (p) IP WB Rabbit IgG AA 275-325 Log in to see Polyclonal
1 ABIN2625991 IF IHC (p) Rabbit IgG AA 275-325 Log in to see Polyclonal


Antigen Neural Precursor Cell Expressed, Developmentally Down-Regulated 4-Like (NEDD4L) Antibodies
Reactivity Human
(52), (49), (31), (6), (5), (5), (5), (4), (3), (1), (1), (1), (1), (1)
Host Rabbit
(59), (7)
Conjugate Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(45), (23), (13), (6), (6), (5), (4), (2), (1), (1)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLPPGWEM
Isotype IgG

Target Details

Product details Application Details Handling Images back to top
Alternative Name NEDD4L (NEDD4L Antibody Abstract)
Background Gene Symbol: NEDD4L
Gene ID 23327
Research Area Enzymes
Pathways Negative Regulation of Transporter Activity

Application Details

Product details Target Details Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product details Target Details Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product details Target Details Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Neural Precursor Cell Expressed, Developmentally Down-Regulated 4-Like (NEDD4L) antibody (ABIN4338490) Immunohistochemistry: NEDD4L Antibody [NBP1-81508] - Staining of human colon shows mo...