anti-Mouse (Murine) Neural Precursor Cell Expressed, Developmentally Down-Regulated 4-Like antibody for Western Blotting

Recommended Neural Precursor Cell Expressed, Developmentally Down-Regulated 4-Like Antibody (supplied by: Log in to see )

Neural Precursor Cell Expressed, Developmentally Down-Regulated 4-Like (NEDD4L) Antibodies
  • NEDD4-2
  • NEDD4.2
  • RSP5
  • hNEDD4-2
  • nedd4
  • nedd4-2
  • NEDD4
  • Nedd4-2
  • 1300012C07Rik
  • Nedd4b
  • neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase
  • NEDD4L
  • neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase S homeolog
  • neural precursor cell expressed, developmentally down-regulated gene 4-like
  • NEDD4L
  • LOC776799
  • nedd4l.S
  • Nedd4l
Middle Region
Human, Mouse (Murine), Rat (Rattus)
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN631206
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.197358 ABIN2774731 WB Rabbit Middle Region Log in to see Polyclonal 1
10.697358 ABIN2737237 WB Rabbit IgG Log in to see Polyclonal 0
10.697358 ABIN6571555 IHC WB Rabbit IgG Log in to see Polyclonal 0
10.697358 ABIN3046951 IHC WB Rabbit IgG Log in to see Polyclonal 0
7.697358 ABIN6255345 IHC WB Rabbit IgG pSer448 Log in to see Polyclonal 0
7.697358 ABIN2690521 ICC WB Rabbit Log in to see Polyclonal 0
4.697358 ABIN953641 EIA WB Rabbit Ig Fraction AA 575-604, Middle Region Log in to see Polyclonal 3
4.697358 ABIN6268178 ELISA WB Rabbit IgG pSer342 Log in to see Polyclonal 0
4.697358 ABIN6268594 ELISA WB Rabbit IgG Log in to see Polyclonal 0
4.697358 ABIN6263580 ELISA WB Rabbit IgG Log in to see Polyclonal 0
4.697358 ABIN1538510 WB Rabbit Ig Fraction AA 576-604, Center Log in to see Polyclonal 0
4.697358 ABIN5693274 ELISA WB Rabbit AA 703-975 Log in to see Polyclonal 0
4.697358 ABIN5929401 WB Rabbit Log in to see Polyclonal 0
4.697358 ABIN2998370 WB Rabbit IgG Log in to see Polyclonal 0
4.697358 ABIN6715696 IF IHC WB Rabbit Log in to see Polyclonal 0
4.697358 ABIN6719042 WB Rabbit pSer448 Log in to see Polyclonal 0
4.697358 ABIN5647890 ELISA WB Rabbit IgG Log in to see Polyclonal 0
4 ABIN5537199 WB Rabbit Ig Fraction AA 576-604 Log in to see Polyclonal 0
4 ABIN2625990 IF IHC IHC (p) IP WB Rabbit IgG AA 275-325 Log in to see Polyclonal 0
4 ABIN2625989 IF IHC IHC (p) IP WB Rabbit IgG AA 225-275 Log in to see Polyclonal 0


Antigen Neural Precursor Cell Expressed, Developmentally Down-Regulated 4-Like (NEDD4L) Antibodies
Epitope Middle Region
(16), (10), (8), (8), (7), (4), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(66), (62), (38), (5), (4), (4), (4), (3), (2), (1)
Host Rabbit
(77), (6)
Conjugate Un-conjugated
(4), (4), (4), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(61), (39), (21), (13), (7), (6), (5), (2), (1)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Specificity NEDD4 L antibody was raised against the middle region of NEDD4
Purification Affinity purified
Immunogen NEDD4 L antibody was raised using the middle region of NEDD4 corresponding to a region with amino acids TVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLP

Target Details

Product details Application Details Handling Images back to top
Alternative Name NEDD4L (NEDD4L Antibody Abstract)
Background NEDD4L is an E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. NEDD4L inhibits TGF-beta signaling by triggering SMAD2 and TGFR1 ubiquitination and proteasome-dependent degradation.
Molecular Weight 110 kDa (MW of target protein)
Pathways Negative Regulation of Transporter Activity

Application Details

Product details Target Details Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

NEDD4L Blocking Peptide, catalog no. 33R-9373, is also available for use as a blocking control in assays to test for specificity of this NEDD4L antibody

Restrictions For Research Use only


Product details Target Details Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEDD0 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Product details Target Details Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Neural Precursor Cell Expressed, Developmentally Down-Regulated 4-Like (NEDD4L) (Middle Region) antibody (ABIN631206) NEDD4L antibody used at 1 ug/ml to detect target protein.