anti-Mouse (Murine) EGFR antibody for Western Blotting

Recommended EGFR Antibody (supplied by: Log in to see )

Antigen
Epidermal Growth Factor Receptor (EGFR) Antibodies
  • C-erb
  • CG10079
  • D-EGFR
  • D-Egf
  • DEGFR
  • DER
  • DER flb
  • DER/EGFR
  • DER/faint little ball
  • DER/top
  • DER/torpedo
  • DER1
  • DEgfr
  • Degfr
  • Der
  • DmHD-33
  • Dmel\\CG10079
  • EFG-R
  • EGF-R
  • EGFR
  • EGFr
  • EGfr
  • EK2-6
  • Egf
  • Egf-r
  • EgfR
  • El
  • Elp
  • Elp-1
  • Elp-B1
  • Elp-B1RB1
  • HD-33
  • TOP
  • Torpedo/DER
  • Torpedo/Egfr
  • c-erbB
  • d-egf-r
  • dEGFR
  • dEGFR1
  • dEgfr
  • der
  • egfr
  • flb
  • l(2)05351
  • l(2)09261
  • l(2)57DEFa
  • l(2)57EFa
  • l(2)57Ea
  • mor1
  • top
  • top/DER
  • top/flb
  • torpedo/Egfr
  • torpedo/egfr
  • EGFR12
  • EGFR15
  • egfr1
  • Erbb2
  • ERBB
  • ERBB1
  • HER1
  • PIG61
  • mENA
  • ErbB-1
  • Errp
  • 9030024J15Rik
  • AI552599
  • Erbb
  • Errb1
  • Wa5
  • wa-2
  • wa2
  • epidermal growth factor receptor
  • Epidermal growth factor receptor
  • epidermal growth factor receptor a (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian)
  • EGFR
  • Egfr
  • egfra
  • egfr1
  • LOC5564544
Reactivity
Human, Mouse (Murine), Rat (Rattus)
2438
874
743
29
27
20
19
16
14
7
4
3
2
2
2
2
2
2
2
1
1
1
1
Host
Rabbit
1498
858
75
24
14
5
2
1
1
Clonality
Polyclonal
Conjugate
This EGFR antibody is un-conjugated
98
73
70
63
53
46
44
29
26
24
23
22
21
21
21
21
21
21
21
20
19
19
19
19
19
19
17
17
15
8
8
8
8
8
8
8
8
8
8
8
8
8
2
2
2
2
2
2
2
2
2
2
2
2
2
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
1484
697
598
592
480
388
272
247
119
89
86
56
55
40
24
22
19
11
10
9
8
4
4
3
3
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4307205
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
3.0644736 ABIN152028 ICC IF IHC IHC (p) IP PLA WB Rabbit C-Term Log in to see Polyclonal 1
3.0644736 ABIN2788648 WB Rabbit Middle Region Log in to see Polyclonal 0
3.0644736 ABIN5518909 WB Rabbit IgG AA 25-57, N-Term Log in to see Polyclonal 0
3.0644736 ABIN2706075 IC IF IHC WB Rabbit pSer693 Log in to see Polyclonal 0
3.0644736 ABIN2704749 WB Rabbit C-Term, pSer1071 Log in to see Polyclonal 0
3.0644736 ABIN2704750 IHC WB Rabbit C-Term Log in to see Polyclonal 0
3.0644736 ABIN2706077 IHC WB Rabbit Center Log in to see Polyclonal 0
3.0644736 ABIN2706076 WB Rabbit pSer678 Log in to see Polyclonal 0
3.0644736 ABIN2706078 IC IF IHC WB Rabbit Center Log in to see Polyclonal 0
3.0644736 ABIN2704752 IC IF IHC WB Rabbit C-Term Log in to see Polyclonal 0
3.0644736 ABIN2704748 WB Rabbit C-Term, pTyr1069 Log in to see Polyclonal 0
3.0644736 ABIN391943 IHC (p) WB Rabbit Ig Fraction AA 1048-1077, Ser1070 Log in to see Polyclonal 5
3.0644736 ABIN1532007 ELISA WB Rabbit IgG AA 991-1040, pSer1026 Log in to see Polyclonal 1
3.0644736 ABIN1532852 IHC ELISA WB Rabbit IgG AA 1139-1188 Log in to see Polyclonal 1
3.0644736 ABIN1532008 ELISA WB Rabbit IgG AA 1036-1085, pSer1071 Log in to see Polyclonal 1
3.0644736 ABIN1532602 ELISA WB Rabbit IgG AA 1031-1080 Log in to see Polyclonal 1
3.0644736 ABIN1533044 ELISA WB Rabbit IgG AA 991-1040 Log in to see Polyclonal 1
3.0644736 ABIN1533045 ELISA WB Rabbit IgG AA 1036-1085 Log in to see Polyclonal 1
3.0644736 ABIN1533046 ELISA WB Rabbit IgG AA 966-1015 Log in to see Polyclonal 1
3.0644736 ABIN2854754 ICC FACS IF IP IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0

General

Antigen Epidermal Growth Factor Receptor (EGFR) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(2438), (874), (743), (29), (27), (20), (19), (16), (14), (7), (4), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Host Rabbit
(1498), (858), (75), (24), (14), (5), (2), (1), (1)
Clonality
Polyclonal
Conjugate This EGFR antibody is un-conjugated
(98), (73), (70), (63), (53), (46), (44), (29), (26), (24), (23), (22), (21), (21), (21), (21), (21), (21), (21), (20), (19), (19), (19), (19), (19), (19), (17), (17), (15), (8), (8), (8), (8), (8), (8), (8), (8), (8), (8), (8), (8), (8), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(1484), (697), (598), (592), (480), (388), (272), (247), (119), (89), (86), (56), (55), (40), (24), (22), (19), (11), (10), (9), (8), (4), (4), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-EGFR Antibody

Target Details EGFR Application Details Handling References for anti-EGFR antibody (ABIN4307205) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids 1019-1168 of human EGFR's cytoplasmic domain (UniProtKB - P00533): QQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLD
Isotype IgG
Plasmids, Primers & others

Target Details EGFR

Product Details anti-EGFR Antibody Application Details Handling References for anti-EGFR antibody (ABIN4307205) Images back to top
Antigen
Alternative Name EGF R/ErbB1 (EGFR Antibody Abstract)
Background Gene Symbol: EGFR
Gene ID 1956
UniProt P00533
Pathways NF-kappaB Signaling, RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Stem Cell Maintenance, Hepatitis C, Positive Regulation of Response to DNA Damage Stimulus, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, EGFR Downregulation

Application Details

Product Details anti-EGFR Antibody Target Details EGFR Handling References for anti-EGFR antibody (ABIN4307205) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-EGFR Antibody Target Details EGFR Application Details References for anti-EGFR antibody (ABIN4307205) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-EGFR antibody (ABIN4307205)

Product Details anti-EGFR Antibody Target Details EGFR Application Details Handling Images back to top
Product cited in:

Luke, Myers, Emelianov, Sokolov: "Sentinel lymph node biopsy revisited: ultrasound-guided photoacoustic detection of micrometastases using molecularly targeted plasmonic nanosensors." in: Cancer research, Vol. 74, Issue 19, pp. 5397-408, 2014 (Sample species: Mouse (Murine)). Further details: Immunohistochemistry

Arabi, Ullah, Branca, Johansson, Bandarra, Haneklaus, Fu, Ariës, Nilsson, Den Boer, Pokrovskaja, Grandér, Xiao, Rocha, Lehtiö, Sangfelt: "Proteomic screen reveals Fbw7 as a modulator of the NF-κB pathway." in: Nature communications, Vol. 3, pp. 976, 2012

Images

Product Details anti-EGFR Antibody Target Details EGFR Application Details Handling References for anti-EGFR antibody (ABIN4307205) back to top
Supplier Images
Western Blotting (WB) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Western Blot: EGF R/ErbB1 Antibody [NBP1-84814] - Lane 1: Marker [kDa] 230, 130, 95, ...
Western Blotting (WB) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Western Blot: EGF R/ErbB1 Antibody [NBP1-84814] - Lane 1: NIH-3T3 cell lysate (Mouse ...
Immunofluorescence (IF) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Immunocytochemistry/Immunofluorescence: EGF R/ErbB1 Antibody [NBP1-84814] - Staining ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Immunohistochemistry-Paraffin: EGF R/ErbB1 Antibody [NBP1-84814] - Staining of human ...
Western Blotting (WB) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Western Blot: EGFR Antibody - Analysis in mouse cell line NIH-3T3 and rat cell line ...
Western Blotting (WB) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Western Blot: EGFR Antibody - Analysis in human cell line A-549.
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Immunohistochemistry-Paraffin: EGFR Antibody - Staining in human placenta and tonsil...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Immunohistochemistry-Paraffin: EGFR Antibody - Staining of human tonsil shows low ex...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Immunohistochemistry-Paraffin: EGFR Antibody - Staining of human placenta shows high...