anti-Rat (Rattus) EGFR antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended EGFR Antibody (supplied by: Log in to see )

Antigen
Epidermal Growth Factor Receptor (EGFR) Antibodies
  • C-erb
  • CG10079
  • D-EGFR
  • D-Egf
  • DEGFR
  • DER
  • DER flb
  • DER/EGFR
  • DER/faint little ball
  • DER/top
  • DER/torpedo
  • DER1
  • DEgfr
  • Degfr
  • Der
  • DmHD-33
  • Dmel\\CG10079
  • EFG-R
  • EGF-R
  • EGFR
  • EGFr
  • EGfr
  • EK2-6
  • Egf
  • Egf-r
  • EgfR
  • El
  • Elp
  • Elp-1
  • Elp-B1
  • Elp-B1RB1
  • HD-33
  • TOP
  • Torpedo/DER
  • Torpedo/Egfr
  • c-erbB
  • d-egf-r
  • dEGFR
  • dEGFR1
  • dEgfr
  • der
  • egfr
  • flb
  • l(2)05351
  • l(2)09261
  • l(2)57DEFa
  • l(2)57EFa
  • l(2)57Ea
  • mor1
  • top
  • top/DER
  • top/flb
  • torpedo/Egfr
  • torpedo/egfr
  • EGFR12
  • EGFR15
  • egfr1
  • Erbb2
  • ERBB
  • ERBB1
  • HER1
  • PIG61
  • mENA
  • ErbB-1
  • Errp
  • 9030024J15Rik
  • AI552599
  • Erbb
  • Errb1
  • Wa5
  • wa-2
  • wa2
  • epidermal growth factor receptor
  • Epidermal growth factor receptor
  • epidermal growth factor receptor a (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian)
  • EGFR
  • Egfr
  • egfra
  • egfr1
  • LOC5564544
Reactivity
Human, Mouse (Murine), Rat (Rattus)
2409
846
684
29
24
18
17
15
15
8
3
2
2
1
1
1
1
Host
Rabbit
1450
852
81
44
9
5
2
1
1
Clonality
Polyclonal
Conjugate
This EGFR antibody is un-conjugated
103
82
73
65
56
54
54
32
32
28
28
28
28
28
28
28
26
25
24
24
21
21
21
21
21
21
20
18
2
2
2
2
2
2
2
2
2
2
2
2
2
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
1475
678
615
543
501
272
262
227
124
84
65
56
43
24
19
14
12
11
11
4
4
4
3
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4307205
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.745287 ABIN214559 IHC (p) ELISA WB Rabbit AA 1189-1199 Log in to see Polyclonal 0
12.745287 ABIN457474 ICC IF IHC (p) IP ELISA WB Sheep IgG Internal Region Log in to see Polyclonal 0
12.745287 ABIN265742 ICC IF IHC (p) IHC ELISA WB Mouse IgG1 Log in to see 29-1 2
12.745287 ABIN315685 IHC (p) IHC ELISA WB Rabbit pTyr1197 Log in to see Polyclonal 0
12.745287 ABIN4307186 IHC IHC (p) WB Rabbit pTyr1092 Log in to see Polyclonal 0
12.745287 ABIN725720 IF (p) IHC (p) Rabbit IgG AA 975-1015 Log in to see Polyclonal 0
12.745287 ABIN498778 IHC (p) Rabbit pTyr1092 Log in to see Polyclonal 0
12.745287 ABIN498727 IHC (p) WB Rabbit pTyr1197 Log in to see Polyclonal 0
12.745287 ABIN498781 IHC (p) Rabbit pTyr869 Log in to see Polyclonal 0
12.745287 ABIN498782 IHC (p) Rabbit pTyr1110 Log in to see Polyclonal 0
12.745287 ABIN498779 IHC (p) Rabbit pTyr1172 Log in to see Polyclonal 0
12.745287 ABIN498780 IHC (p) Rabbit pTyr1197 Log in to see Polyclonal 0
12.745287 ABIN364308 ICC IHC (p) IP WB Sheep Internal Region Log in to see Polyclonal 0
12.745287 ABIN4307180 IHC IHC (p) WB Rabbit Log in to see Polyclonal 0
12.745287 ABIN4307194 IHC IHC (p) WB Rabbit pTyr1197 Log in to see Polyclonal 0
12.745287 ABIN218581 IHC (p) IP ELISA WB Rabbit AA 1166-1180 Log in to see Polyclonal 0
12.745287 ABIN4307176 IHC IHC (p) WB Rabbit pSer1046 Log in to see Polyclonal 0
12.745287 ABIN4307181 ICC IF IHC IHC (p) WB Rabbit Log in to see Polyclonal 0
12.745287 ABIN615211 IF IHC (p) IP WB Sheep Internal Region Log in to see Polyclonal 0
12.745287 ABIN498870 IHC (p) Rabbit Log in to see Polyclonal 0

General

Antigen Epidermal Growth Factor Receptor (EGFR) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(2409), (846), (684), (29), (24), (18), (17), (15), (15), (8), (3), (2), (2), (1), (1), (1), (1)
Host Rabbit
(1450), (852), (81), (44), (9), (5), (2), (1), (1)
Clonality
Polyclonal
Conjugate This EGFR antibody is un-conjugated
(103), (82), (73), (65), (56), (54), (54), (32), (32), (28), (28), (28), (28), (28), (28), (28), (26), (25), (24), (24), (21), (21), (21), (21), (21), (21), (20), (18), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(1475), (678), (615), (543), (501), (272), (262), (227), (124), (84), (65), (56), (43), (24), (19), (14), (12), (11), (11), (4), (4), (4), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-EGFR Antibody

Target Details EGFR Application Details Handling References for anti-EGFR antibody (ABIN4307205) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids 1019-1168 of human EGFR's cytoplasmic domain (UniProtKB - P00533): QQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLD
Isotype IgG

Target Details EGFR

Product Details anti-EGFR Antibody Application Details Handling References for anti-EGFR antibody (ABIN4307205) Images back to top
Antigen
Alternative Name EGF R/ErbB1 (EGFR Antibody Abstract)
Background Gene Symbol: EGFR
Gene ID 1956
UniProt P00533
Pathways NF-kappaB Signaling, RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Stem Cell Maintenance, Hepatitis C, Positive Regulation of Response to DNA Damage Stimulus, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, EGFR Downregulation

Application Details

Product Details anti-EGFR Antibody Target Details EGFR Handling References for anti-EGFR antibody (ABIN4307205) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-EGFR Antibody Target Details EGFR Application Details References for anti-EGFR antibody (ABIN4307205) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-EGFR antibody (ABIN4307205)

Product Details anti-EGFR Antibody Target Details EGFR Application Details Handling Images back to top
Product cited in:

Luke, Myers, Emelianov, Sokolov: "Sentinel lymph node biopsy revisited: ultrasound-guided photoacoustic detection of micrometastases using molecularly targeted plasmonic nanosensors." in: Cancer research, Vol. 74, Issue 19, pp. 5397-408, 2014 (Sample species: Mouse (Murine)). Further details: Immunohistochemistry

Arabi, Ullah, Branca, Johansson, Bandarra, Haneklaus, Fu, Ariës, Nilsson, Den Boer, Pokrovskaja, Grandér, Xiao, Rocha, Lehtiö, Sangfelt: "Proteomic screen reveals Fbw7 as a modulator of the NF-κB pathway." in: Nature communications, Vol. 3, pp. 976, 2012

Images

Product Details anti-EGFR Antibody Target Details EGFR Application Details Handling References for anti-EGFR antibody (ABIN4307205) back to top
Supplier Images
Western Blotting (WB) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Western Blot: EGF R/ErbB1 Antibody [NBP1-84814] - Lane 1: Marker [kDa] 230, 130, 95, ...
Western Blotting (WB) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Western Blot: EGF R/ErbB1 Antibody [NBP1-84814] - Lane 1: NIH-3T3 cell lysate (Mouse ...
Immunofluorescence (IF) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Immunocytochemistry/Immunofluorescence: EGF R/ErbB1 Antibody [NBP1-84814] - Staining ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Immunohistochemistry-Paraffin: EGF R/ErbB1 Antibody [NBP1-84814] - Staining of human ...
Western Blotting (WB) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Western Blot: EGFR Antibody - Analysis in mouse cell line NIH-3T3 and rat cell line ...
Western Blotting (WB) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Western Blot: EGFR Antibody - Analysis in human cell line A-549.
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Immunohistochemistry-Paraffin: EGFR Antibody - Staining in human placenta and tonsil...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Immunohistochemistry-Paraffin: EGFR Antibody - Staining of human tonsil shows low ex...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Immunohistochemistry-Paraffin: EGFR Antibody - Staining of human placenta shows high...