anti-Human LTB antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended LTB Antibody (supplied by: Log in to see )

Lymphotoxin beta (TNF Superfamily, Member 3) (LTB) Antibodies
  • AI662801
  • LTbeta
  • Tnfc
  • Tnfsf3
  • p33
  • TNFC
  • TNFSF3
  • LT-b
  • LT-beta
  • TNF-C
  • lymphotoxin B
  • lymphotoxin beta
  • Ltb
  • LTB
This LTB antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4331997
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN4901899 ELISA IHC (p) Rabbit IgG AA 41-90 Log in to see Polyclonal 0
1 ABIN1714564 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2742676 ICC IF IHC IHC (p) WB Rabbit C-Term Log in to see Polyclonal 0
1 ABIN1712079 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal 0
1 ABIN1701062 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal 0
1 ABIN5959657 ELISA IHC (p) Rabbit IgG Log in to see Polyclonal 0


Antigen Lymphotoxin beta (TNF Superfamily, Member 3) (LTB) Antibodies
Reactivity Human
(54), (41), (19), (8), (5), (4), (3), (3), (3), (2), (2)
Host Rabbit
(65), (11), (5)
Conjugate This LTB antibody is un-conjugated
(7), (6), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(55), (31), (16), (13), (13), (12), (7), (6), (4), (3), (3), (1)
Supplier Log in to see

Product Details anti-LTB Antibody

Target Details LTB Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: GGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQG LGWETTKEQAFLTSGTQFSD
Isotype IgG
Plasmids, Primers & others

Target Details LTB

Product Details anti-LTB Antibody Application Details Handling Images back to top
Alternative Name Lymphotoxin beta/tnfsf3 (LTB Antibody Abstract)
Background Gene Symbol: LTB
Gene ID 4050
Pathways NF-kappaB Signaling

Application Details

Product Details anti-LTB Antibody Target Details LTB Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-LTB Antibody Target Details LTB Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-LTB Antibody Target Details LTB Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Lymphotoxin beta (TNF Superfamily, Member 3) (LTB) antibody (ABIN4331997) Immunohistochemistry-Paraffin: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207] - Staini...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Lymphotoxin beta (TNF Superfamily, Member 3) (LTB) antibody (ABIN4331997) Immunohistochemistry-Paraffin: Lymphotoxin beta/TNFSF3 Antibody - Staining of human ...
Immunofluorescence (IF) image for anti-Lymphotoxin beta (TNF Superfamily, Member 3) (LTB) antibody (ABIN4331997) Immunocytochemistry/Immunofluorescence: Lymphotoxin beta/TNFSF3 Antibody - Immunoflu...