anti-Human Proprotein Convertase Subtilisin/kexin Type 2 antibody for Immunohistochemistry

Recommended Proprotein Convertase Subtilisin/kexin Type 2 Antibody (supplied by: Log in to see )

Antigen
Proprotein Convertase Subtilisin/kexin Type 2 (PCSK2) Antibodies
  • NEC 2
  • NEC-2
  • NEC2
  • PC2
  • SPC2
  • PCSK2
  • 6330411F23Rik
  • AI839700
  • Nec-2
  • Nec2
  • Phpp-2
  • pc2
  • nec2
  • spc2
  • pcsk2
  • pcsk2-A
  • proprotein convertase subtilisin/kexin type 2
  • proprotein convertase subtilisin/kexin type 2 L homeolog
  • PCSK2
  • pcsk2
  • Pcsk2
  • pcsk2.L
Reactivity
Human
59
32
27
6
3
3
3
2
2
2
2
2
1
1
Host
Rabbit
54
5
1
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC)
44
14
13
10
9
7
5
4
4
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4347753
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.907254 ABIN3032333 FACS IHC ELISA WB Rabbit Ig Fraction AA 318-346 Log in to see Polyclonal 0
8.907254 ABIN3032332 FACS IF IHC ELISA WB Rabbit Ig Fraction AA 87-116 Log in to see Polyclonal 0
1 ABIN2331789 IHC WB Rabbit IgG N-Term Log in to see Polyclonal 0
1 ABIN2793109 FACS IHC WB Rabbit Ig Fraction Center Log in to see Polyclonal 0

General

Antigen Proprotein Convertase Subtilisin/kexin Type 2 (PCSK2) Antibodies
Reactivity Human
(59), (32), (27), (6), (3), (3), (3), (2), (2), (2), (2), (2), (1), (1)
Host Rabbit
(54), (5), (1)
Clonality
Polyclonal
Conjugate Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC)
(44), (14), (13), (10), (9), (7), (5), (4), (4), (1), (1)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids:FTNHFLVELHKGGEDKARQVAAEHGFGVRKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDINMNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHP
Isotype IgG

Target Details

Product details Application Details Handling Images back to top
Antigen
Alternative Name Proprotein Convertase 2/PCSK2 (PCSK2 Antibody Abstract)
Background Gene Symbol: PCSK2
Gene ID 5126
Pathways Peptide Hormone Metabolism, cAMP Metabolic Process, Maintenance of Protein Location, Negative Regulation of Transporter Activity

Application Details

Product details Target Details Handling Images back to top
Application Notes Immunohistochemistry 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product details Target Details Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product details Target Details Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Proprotein Convertase Subtilisin/kexin Type 2 (PCSK2) antibody (ABIN4347753) Immunohistochemistry: Proprotein Convertase 2/PCSK2 Antibody [NBP2-48942] - Staining ...
Immunofluorescence (IF) image for anti-Proprotein Convertase Subtilisin/kexin Type 2 (PCSK2) antibody (ABIN4347753) Immunocytochemistry/Immunofluorescence: Proprotein Convertase 2/PCSK2 Antibody - Sta...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Proprotein Convertase Subtilisin/kexin Type 2 (PCSK2) antibody (ABIN4347753) Immunohistochemistry-Paraffin: Proprotein Convertase 2/PCSK2 Antibody - Staining of ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Proprotein Convertase Subtilisin/kexin Type 2 (PCSK2) antibody (ABIN4347753) Immunohistochemistry-Paraffin: Proprotein Convertase 2/PCSK2 Antibody - Staining of ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Proprotein Convertase Subtilisin/kexin Type 2 (PCSK2) antibody (ABIN4347753) Immunohistochemistry-Paraffin: Proprotein Convertase 2/PCSK2 Antibody - Staining in ...