anti-Mouse (Murine) FOXO1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended FOXO1 Antibody (supplied by: Log in to see )

Antigen
Forkhead Box O1 (FOXO1) Antibodies
  • FKH1
  • FKHR
  • FOXO1A
  • FoxO1a.1
  • foxo1
  • zgc:153388
  • Fkhr
  • Foxo1a
  • AI876417
  • Afxh
  • Fkhr1
  • fkh1
  • fkhr
  • foxo1a
  • xFoxO1
  • FoxO1A
  • forkhead box O1
  • forkhead box O1 a
  • forkhead box O1 L homeolog
  • FOXO1
  • foxo1a
  • Foxo1
  • foxo1
  • foxo1.L
Reactivity
Human, Mouse (Murine)
451
261
241
31
26
17
13
10
9
6
4
3
3
2
1
1
1
Host
Rabbit
356
101
19
2
Clonality
Polyclonal
Conjugate
This FOXO1 antibody is un-conjugated
11
11
9
6
6
5
5
5
4
4
4
4
4
4
2
2
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
389
219
148
123
113
70
56
21
11
9
4
4
4
4
3
3
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4312363
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
9.951868 ABIN4312364 ELISA ICC IF IHC IHC (p) WB Mouse IgG1 Log in to see 3B6 0
9.951868 ABIN684733 IF (p) IHC (p) WB Rabbit IgG AA 315-325, pSer319 Log in to see Polyclonal 1
9.951868 ABIN498701 IF IHC (p) WB Rabbit pSer256 Log in to see Polyclonal 0
9.951868 ABIN498702 IF IHC (p) WB Rabbit pSer319 Log in to see Polyclonal 0
9.951868 ABIN498786 IHC (p) WB Rabbit pSer319 Log in to see Polyclonal 0
9.951868 ABIN498785 IHC (p) WB Rabbit pSer256 Log in to see Polyclonal 0
9.951868 ABIN5946349 ICC IF IHC IHC (p) WB Rabbit IgG Log in to see SU33-01 0
9.951868 ABIN498580 IF IHC (p) WB Rabbit Log in to see Polyclonal 0
9.951868 ABIN498876 IHC (p) WB Rabbit Log in to see Polyclonal 0
9.951868 ABIN498199 IF IHC (p) WB Rabbit Log in to see Polyclonal 0
9.951868 ABIN498877 IHC (p) WB Rabbit Log in to see Polyclonal 0
9.951868 ABIN784062 EIA IF IHC (p) WB Rabbit IgG N-Term Log in to see Polyclonal 0
9.951868 ABIN5557370 IF (cc) IHC (p) WB Rabbit IgG Log in to see 3G1 0
1 ABIN257291 ICC IF IHC (p) IHC WB Rabbit pSer256 Log in to see Polyclonal 1
1 ABIN196812 IF IHC (p) WB Rabbit pSer256 Log in to see Polyclonal 4
1 ABIN197366 IHC (p) WB Rabbit Ser319 Log in to see Polyclonal 3
1 ABIN768735 IHC IHC (p) WB Rabbit IgG AA 373-422 Log in to see Polyclonal 0
1 ABIN196848 IF IHC (p) WB Rabbit pSer319 Log in to see Polyclonal 3
1 ABIN2878939 ELISA IF IHC IHC (p) WB Rabbit IgG AA 295-344 Log in to see Polyclonal 0
1 ABIN1107270 EIA IF IHC (p) WB Mouse IgG1 Log in to see 3B6 2

General

Antigen Forkhead Box O1 (FOXO1) Antibodies
Reactivity Human, Mouse (Murine)
(451), (261), (241), (31), (26), (17), (13), (10), (9), (6), (4), (3), (3), (2), (1), (1), (1)
Host Rabbit
(356), (101), (19), (2)
Clonality
Polyclonal
Conjugate This FOXO1 antibody is un-conjugated
(11), (11), (9), (6), (6), (5), (5), (5), (4), (4), (4), (4), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(389), (219), (148), (123), (113), (70), (56), (21), (11), (9), (4), (4), (4), (4), (3), (3), (2), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-FOXO1 Antibody

Target Details FOXO1 Application Details Handling References for anti-FOXO1 antibody (ABIN4312363) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDM
Isotype IgG
Plasmids, Primers & others

Target Details FOXO1

Product Details anti-FOXO1 Antibody Application Details Handling References for anti-FOXO1 antibody (ABIN4312363) Images back to top
Antigen
Alternative Name FoxO1/FKHR (FOXO1 Antibody Abstract)
Background Gene Symbol: FOXO1
Gene ID 2308
Pathways PI3K-Akt Signaling, Cell Division Cycle, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Carbohydrate Homeostasis, Chromatin Binding, Regulation of Carbohydrate Metabolic Process, CXCR4-mediated Signaling Events

Application Details

Product Details anti-FOXO1 Antibody Target Details FOXO1 Handling References for anti-FOXO1 antibody (ABIN4312363) Images back to top
Application Notes Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:20-1:50For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-FOXO1 Antibody Target Details FOXO1 Application Details References for anti-FOXO1 antibody (ABIN4312363) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-FOXO1 antibody (ABIN4312363)

Product Details anti-FOXO1 Antibody Target Details FOXO1 Application Details Handling Images back to top
Product cited in:

Sahu, Laakso, Ovaska, Mirtti, Lundin, Rannikko, Sankila, Turunen, Lundin, Konsti, Vesterinen, Nordling, Kallioniemi, Hautaniemi, Jänne: "Dual role of FoxA1 in androgen receptor binding to chromatin, androgen signalling and prostate cancer." in: The EMBO journal, Vol. 30, Issue 19, pp. 3962-76, 2011

Kato, Nicholson, Neiman, Rantalainen, Holmes, Barrett, Uhlén, Nilsson, Spector, Schwenk: "Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model." in: Proteome science, Vol. 9, pp. 73, 2011

Images

Product Details anti-FOXO1 Antibody Target Details FOXO1 Application Details Handling References for anti-FOXO1 antibody (ABIN4312363) back to top
Supplier Images
Immunofluorescence (IF) image for anti-Forkhead Box O1 (FOXO1) antibody (ABIN4312363) Immunocytochemistry/Immunofluorescence: FoxO1/FKHR Antibody [NBP1-84674] - Staining o...
Immunofluorescence (IF) image for anti-Forkhead Box O1 (FOXO1) antibody (ABIN4312363) Immunocytochemistry/Immunofluorescence: FoxO1/FKHR Antibody [NBP1-84674] - Staining o...
Immunofluorescence (IF) image for anti-Forkhead Box O1 (FOXO1) antibody (ABIN4312363) Immunocytochemistry/Immunofluorescence: FoxO1/FKHR Antibody [NBP1-84674] - Staining o...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Forkhead Box O1 (FOXO1) antibody (ABIN4312363) Immunohistochemistry-Paraffin: FoxO1/FKHR Antibody [NBP1-84674] - Staining of human c...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Forkhead Box O1 (FOXO1) antibody (ABIN4312363) Immunohistochemistry-Paraffin: FoxO1/FKHR Antibody [NBP1-84674] - Staining of human c...
Immunofluorescence (IF) image for anti-Forkhead Box O1 (FOXO1) antibody (ABIN4312363) Immunocytochemistry/Immunofluorescence: FoxO1/FKHR Antibody [NBP1-84674] - Staining o...
Immunofluorescence (IF) image for anti-Forkhead Box O1 (FOXO1) antibody (ABIN4312363) Immunocytochemistry/Immunofluorescence: FoxO1/FKHR Antibody [NBP1-84674] - Staining o...