anti-Human PPP2R3B antibody for Western Blotting

Recommended PPP2R3B Antibody (supplied by: Log in to see )

Antigen
Protein Phosphatase 2A 48 KDa Regulatory Subunit (PPP2R3B) Antibodies
  • NYREN8
  • PPP2R3L
  • PPP2R3LY
  • PR48
  • im:6895423
  • si:ch211-269e2.2
  • protein phosphatase 2 regulatory subunit B''beta
  • serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta
  • protein phosphatase 2, regulatory subunit B'', beta
  • protein phosphatase 2 regulatory subunit B', beta L homeolog
  • PPP2R3B
  • LOC607103
  • ppp2r3b
  • ppp2r3b.L
  • Ppp2r3b
Reactivity
Human
51
3
2
2
2
2
1
1
1
1
Host
Rabbit
43
8
Clonality
Polyclonal
Conjugate
This PPP2R3B antibody is un-conjugated
1
1
1
Application
Western Blotting (WB)
45
22
7
4
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN634157
€ 419.41
Plus shipping costs €45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
17.063175 ABIN634169 WB Rabbit Log in to see Polyclonal 0
17.063175 ABIN6146091 WB Rabbit Log in to see Polyclonal 0
13.25679 ABIN3186547 ELISA WB Rabbit IgG Internal Region Log in to see Polyclonal 0
13 ABIN525999 IF IP ELISA WB Mouse IgG2b kappa AA 1-225 Log in to see 2E12 0
10 ABIN526000 IP ELISA WB Mouse IgG1 kappa AA 1-176 Log in to see 1F4 0
9.306385 ABIN2775379 WB Rabbit C-Term Log in to see Polyclonal 2
7.8063846 ABIN6257425 ELISA ICC IF WB Rabbit IgG Log in to see Polyclonal 0
7.8063846 ABIN525996 IF WB Mouse AA 1-176 Log in to see Polyclonal 0
7.8063846 ABIN525998 WB Rabbit AA 1-225 Log in to see Polyclonal 0
4.8063846 ABIN2773803 WB Rabbit C-Term Log in to see Polyclonal 1
4.8063846 ABIN2775378 WB Rabbit N-Term Log in to see Polyclonal 0
4.8063846 ABIN1535352 ELISA WB Rabbit IgG AA 364-413 Log in to see Polyclonal 0
4.8063846 ABIN392195 WB Rabbit Ig Fraction AA 25-54, N-Term Log in to see Polyclonal 0
4.8063846 ABIN2737404 WB Rabbit IgG Log in to see Polyclonal 0
4.8063846 ABIN2462575 ELISA WB Rabbit Log in to see Polyclonal 0
4.8063846 ABIN6571792 WB Rabbit IgG Log in to see Polyclonal 0
4.8063846 ABIN525993 WB Mouse AA 1-225 Log in to see Polyclonal 0
4.8063846 ABIN5586074 WB Rabbit Log in to see Polyclonal 0
4.8063846 ABIN525997 WB Rabbit AA 1-176 Log in to see Polyclonal 0
4.8063846 ABIN3046547 WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Protein Phosphatase 2A 48 KDa Regulatory Subunit (PPP2R3B) Antibodies
Reactivity Human
(51), (3), (2), (2), (2), (2), (1), (1), (1), (1)
Host Rabbit
(43), (8)
Clonality
Polyclonal
Conjugate This PPP2R3B antibody is un-conjugated
(1), (1), (1)
Application Western Blotting (WB)
(45), (22), (7), (4), (2), (1)
Supplier Log in to see

Product Details anti-PPP2R3B Antibody

Target Details PPP2R3B Application Details Handling Images
Purification Affinity purified
Immunogen PPP2 R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETA
Plasmids, Primers & others

Target Details PPP2R3B

Product Details anti-PPP2R3B Antibody Application Details Handling Images back to top
Antigen
Alternative Name PPP2R3B (PPP2R3B Antibody Abstract)
Background Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B.
Molecular Weight 65 kDa (MW of target protein)
Pathways PI3K-Akt Signaling, Mitotic G1-G1/S Phases

Application Details

Product Details anti-PPP2R3B Antibody Target Details PPP2R3B Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

PPP2R3B Blocking Peptide, catalog no. 33R-9062, is also available for use as a blocking control in assays to test for specificity of this PPP2R3B antibody

Restrictions For Research Use only

Handling

Product Details anti-PPP2R3B Antibody Target Details PPP2R3B Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product Details anti-PPP2R3B Antibody Target Details PPP2R3B Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Protein Phosphatase 2A 48 KDa Regulatory Subunit (PPP2R3B) antibody (ABIN634157) PPP2R3B antibody used at 1 ug/ml to detect target protein.